Covalent targeting of E3 ligases

This application is the national stage filing under 35 U.S.C. § 371 of International Application No. PCT/US2019/055461 filed Oct. 9, 2019, which claims the benefit of U.S. Provisional Application No. 62/743,337, filed Oct. 9, 2018, which are incorporated herein by reference in their entirety and for all purposes.

REFERENCE TO A “SEQUENCE LISTING,” A TABLE, OR A COMPUTER PROGRAM LISTING APPENDIX SUBMITTED AS AN ASCII FILE

The Sequence Listing written in file 052103-517N01US_Sequence_Listing_ST25.txt, created Mar. 16, 2021, 18,717 bytes, machine format IBM-PC, MS Windows operating system, is hereby incorporated by reference.

Targeted protein degradation has arisen as a powerful strategy for the treatment of diseases. This approach employs bifunctional degraders consisting of a protein targeting ligand linked to an E3 ligase recruiter which brings the E3 ligase to particular protein substrates to ubiquitinate and degrade these substrates in a proteasome-dependent manner. One challenge with this approach, however, is the relatively few E3 ligase recruiters that currently exist for targeted protein degradation applications. Described herein, inter alia, are solutions to these and other problems in the art.

In an aspect is a targeted protein degrader including 1) a targeted protein binder and 2) an E3 Ubiquitin ligase binder, wherein the E3 Ubiquitin ligase is human RNF4 or human RNF114.

In an aspect is provided a pharmaceutical composition including a compound as described herein, including embodiments, and a pharmaceutically acceptable excipient.

In an aspect is provided a method of reducing (e.g., reducing relative to a control) the level of a cellular protein, said method including contacting the cellular protein with a targeted protein degrader. In embodiments, the targeted protein degrader is a compound described herein.

In an aspect is provided a method of treating cancer, the method including contacting a cellular protein associated with cancer with a targeted protein degrader (e.g., a compound described herein).

In an aspect is provided a method of treating cancer, the method including administering to a subject in need thereof a therapeutically effective amount of a targeted protein degrader as described herein, including embodiments.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby form a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader includes: (i) a monovalent E3 Ubiquitin ligase binder; (ii) a monovalent targeted protein binder; and (iii) a binder linker directly bonded to the monovalent E3 Ubiquitin ligase binder and the targeted protein binder.

In an aspect is provided a method of identifying a cellular protein contacted by a targeted protein binder including: (A) contacting a first sample of a cell proteome or cell with the targeted protein binder thereby forming a cellular protein-targeted protein binder complex; (B) contacting both the resulting first sample of a cell proteome or cell of step A and a second sample of the cell proteome or cell that has not been contacted with the targeted protein binder, with a compound having the formula:

(C) contacting the resulting first sample of step B with a first detectable agent and the resulting second sample of step B with a second detectable agent; (D) measuring the level of the first detectable agent and second detectable agent bound to selected proteins; and (E) identifying the cellular protein in a cellular protein-targeted protein binder complex by measuring a difference between the level of the first detectable agent and second detectable agent, each bound to the cellular protein capable of forming the cellular protein-targeted protein binder complex.

In an aspect is a method of making an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex including: (A) contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex; and (B) contacting the E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex.

In an aspect is provided a method of making a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex including: (A) contacting the cellular protein with an E3 Ubiquitin ligase binder and thereby forming a cellular protein-E3 Ubiquitin ligase binder complex; and (B) contacting the cellular protein-E3 Ubiquitin ligase binder complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex.

In an aspect is provided a method of inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex including contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex.

FIGS. 1 A- 1 E . Covalent ligand screen against RNF4 using gel-based ABPP. ( FIG. 1 A ) Gel-based ABPP labeling of E3 ligases MDM2, RNF4, and UBE3A. Pure protein was labeled with IA-rhodamine for 30 min at room temperature, followed by SDS/PAGE and visualization by in-gel fluorescence. ( FIG. 1 B ) Schematic of gel-based ABPP screen of covalent ligands (50 μM) against IA-rhodamine labeling of pure RNF4, looking for compounds that inhibit probe labeling resulting in loss of fluorescence. ( FIGS. 1 C- 1 D ) Gel-based ABPP screen of cysteine-reactive covalent ligands against IA-rhodamine labeling of RNF4. Covalent ligands were pre-incubated with pure RNF4 protein for 30 min prior to IA-rhodamine labeling (250 nM) for 1 h. Proteins were subjected to SDS/PAGE and visualized by in-gel fluorescence. Highlighted were potential hits from this screen. ( FIG. 1 E ) Structures and gel-based ABPP confirmation of reproducible RNF4 screening hits, performed as described in ( FIGS. 1 C- 1 D ). Gels were also silver stained.

FIGS. 2 A- 2 C . TRH 1-23 reacts non-functionally with zinc-coordinating cysteines in RNF4. ( FIG. 2 A ) LC-MS/MS analysis of TRH 1-23 covalent adduct on RNF4. RNF4 was incubated with TRH 1-23 (50 μM) for 30 min at RT. RNF4 was digested with trypsin and tryptic digests were analyzed by LC-MS/MS and we searched for the TRH 1-23 modified adduct. Shown are the MS/MS spectra of TRH 1-23-modified C132 and C135 RNF4 tryptic peptide. Highlighted in the peptide sequence is the cysteine that was modified. Peptide sequences correspond to residues 118-147 of SEQ ID NO:1. ( FIG. 2 B ) Schematic of TRH 1-23 reactivity with C132 or C135 of RNF4. ( FIG. 2 C ) TRH 1-23 does not inhibit RNF4 autoubiquitination assay. RNF4 was pre-incubated with TRH 1-23 (100 μM) followed by addition of UBA1, E2 enzyme, and ATP for 40 min at 37 C. The reaction was quenched and subjected to SDS/PAGE and Western blotting for RNF4. Gel shown in ( FIG. 2 C ) is a representative gel from n=3.

FIGS. 3 A- 3 C . Optimizing RNF4 covalent ligands using gel-based ABPP. ( FIGS. 3 A- 3 B ) Analogs of TRH 1-23 were tested against IA-rhodamine labeling of RNF4 using gel-based ABPP. ( FIG. 3 C ) CCW16 was tested against IA-rhodamine labeling of RNF4 using gel-based ABPP. For ( FIGS. 3 A- 3 C ), covalent ligands were pre-incubated with pure RNF4 protein for 30 min prior to IA-rhodamine labeling for 1 h. Proteins were subjected to SDS/PAGE and visualized by in-gel fluorescence. In ( FIG. 3 C ), gels were quantified by densitometry to calculate IC50 values. Gel shown in ( FIG. 3 C ) is a representative gel from n=3.

FIGS. 4 A- 4 F . RNF4 recruiter-based BRD4 degrader. ( FIG. 4 A ) Structure of CCW 28-3, an RNF4-recruiter-based degrader linked to BRD4 inhibitor JQ1. ( FIG. 4 B ) Gel-based ABPP analysis of CCW 28-3 against pure human RNF4. CCW 28-3 was pre-incubated with pure RNF4 protein for 30 min prior to IA-rhodamine labeling for 1 h. Proteins were subjected to SDS/PAGE and visualized by in-gel fluorescence. Gels were quantified by densitometry to calculate IC50 values. ( FIG. 4 C ) CCW 28-3 treatment in 231MFP breast cancer cells leads to BRD4 degradation. 231MFP breast cancer cells were treated with vehicle DMSO or CCW 28-3 for 3 h. Proteins were subjected to SDS/PAGE and Western blotting for BRD4 and GAPDH loading control. ( FIGS. 4 D, 4 E ) CCW 28-3 treatment in 231MFP breast cancer cells leads to proteasome-, E1 inhibitor-, and BRD4 inhibitor-dependent BRD4 degradation. Vehicle DMSO or proteasome inhibitor bortezomib (BTZ) (10 μM), E1 inhibitor TAK-243 (10 μM), or BRD4 inhibitor JQ1 (10 μM) were pre-incubated for 30 min prior to treatment with MZ1 (1 μM) or CCW 28-3 (1 μM) for 3 h. Proteins were subjected to SDS/PAGE and Western blotting for BRD4 and actin loading control. ( FIG. 4 F ) RNF4 wild-type and knockout Hela cells were treated with CCW 28-3 (10 μM) for 5 h and subjected to SDS/PAGE and Western blotting for BRD4, RNF4, and GAPDH. Blots in ( FIGS. 4 B- 4 F ) were quantified by densitometry. Data in ( FIGS. 4 B- 4 F ) are from representative gels from n=3. Bar graphs are average±sem, n=3-5/group. Significance is expressed as *p<0.05 compared to vehicle-treated controls and #p<0.05 compared to CCW 28-3 treated groups in (B, D-E) and CCW 28-3 treated wild-type cells in ( FIG. 4 F ).

FIG. 5 . Additional hits against RNF4 and general assessment of proteome-wide selectivity of RNF4 hits by gel-based ABPP. Gel-based ABPP analysis of DKM 2-76 and TRH 1-74 against IA-rhodamine labeling of RNF4. Covalent ligands were pre-incubated with pure RNF4 protein for 30 min prior to IA-rhodamine labeling (250 nM) for 1 h. Proteins were subjected to SDS/PAGE and visualized by in-gel fluorescence. Gel-based ABPP screen of RNF4 hits YP 1-44 and TRH 1-23 against IA-rhodamine labeling in 231MFP breast cancer cell proteomes. YP 1-44 and TRH 1-23 were pre-incubated with proteome for 30 min prior to IA-rhodamine labeling (250 nM) for 1 h. Proteins were subjected to SDS/PAGE and visualized by in-gel fluorescence.

FIG. 6 . isoTOP-ABPP analysis of CCW 28-3 in 231MFP breast cancer cells in situ. 231MFP cells were treated with DMSO vehicle or CCW 28-3 (10 μM) in situ for 1 h prior to labeling of proteomes in vitro with IA-alkyne (100 μM) for 1h. Isotopically light (for DMSO-treated) or heavy (for compound-treated) TEV protease-cleavable biotin-azide tag were appended by CuAAC for isoTOP-ABPP analysis. Data is for three biological replicates.

FIG. 7 . CCW 28-3 tested at lower concentrations in RNF4 wild-type and knockout Hela cells. RNF4 wild-type and knockout Hela cells were treated with DMSO vehicle or CCW 28-3 (5 or 1 μM) for 5 h and subjected to SDS/PAGE and Western blotting for BRD4 and GAPDH. Blots were quantified by densitometry. Data in are from representative gels from n=3. Bar graphs are average±sem, n=3/group. Significance is expressed as *p<0.05 compared to vehicle-treated controls and #p<0.05 compared to CCW 28-3 treated wild-type cells.

FIGS. 8 A- 8 C . Nimbolide impairs breast cancer cell proliferation or survival. ( FIG. 8 A ) Structure of nimbolide. Nimbolide possesses a cyclic enone that is potentially cysteine-reactive. ( FIGS. 8 B- 8 C ) 231MFP and HCC38 breast cancer cell proliferation in serum-containing media and serum-free cell survival. Cells were treated with DMSO vehicle or nimbolide and cell viability was assessed after 48 h by Hoechst stain. Data shown in ( FIGS. 8 B- 8 C ) are average±sem, n=6/group. Significance is expressed as *p<0.05 compared to vehicle-treated controls.

FIGS. 9 A- 9 E . isoTOP-ABPP analysis of nimbolide in 231MFP breast cancer cell proteomes reveal RNF114 as a target. ( FIG. 9 A ) Schematic of isoTOP-ABPP in which 231MFP breast cancer cell proteomes or cells were pre-treated with DMSO or nimbolide (10 μM, 30 min in vitro or 1.5 h in situ) prior to labeling of proteomes in vitro with IA-alkyne (100 μM, 1 h), followed by appendage of isotopically light (for DMSO-treated) or heavy (for nimbolide-treated) TEV protease cleavable biotin-azide tags by copper-catalyzed azide-alkyne cycloaddition (CuAAC). Control and treated proteomes were subsequently combined in a 1:1 ratio, probe-labeled proteins were avidin-enriched, digested with trypsin, and probe-modified tryptic peptides were eluted by TEV protease, analyzed by LC-MS/MS, and light to heavy probe-modified peptide ratios were quantified. ( FIG. 9 B ) isoTOP-ABPP analysis of nimbolide (10 μM) in 231MFP breast cancer cell proteomes in vitro analyzed as described in ( FIG. 9 A ). Three targets that showed light/heavy ratios >5 included C308 of PTOV1, C8 of RNF114, and C123 of PFKP. ( FIG. 9 C ) isoTOP-ABPP analysis of nimbolide (10 μM) in 231MFP breast cancer cells in situ analyzed as described in ( FIG. 9 A ). ( FIG. 9 D ) RNF114 was stably knocked down using a short-hairpin RNA oligonucleotide in 231MFP cells. RNF114 knockdown in shRNF114 cells was confirmed by qPCR in comparison to shControl cells. Cell proliferation was assessed 48 h after seeding cells by Hoechst stain. ( FIG. 9 E ) 231MFP shControl and shRNF114 sensitivity to nimbolide. 231MFP shControl and shRNF114 cells were treated with DMSO vehicle or nimbolide and cell proliferation was assessed after 48 h by Hoechst stain. % proliferation with nimbolide treatment was normalized against respective shControl or shRNF114 control groups. Data shown in ( FIGS. 9 D- 9 E ) are average±sem. Data shown in ( FIGS. 9 B- 9 E ) are from n=6/group. Significance in ( FIGS. 9 D, 9 E ) is expressed as *p<0.05 compared to shControl groups.

FIGS. 10 A- 10 E . Nimbolide reacts covalently with C8 of RNF114. ( FIG. 10 A ) Nimbolide targets an intrinsically disordered region within RNF114 as assessed by PONDR. ( FIG. 10 B ) Route for synthesis of the alkyne-functionalized nimbolide probe. ( FIG. 10 C ) Nimbolide probe labeling of 231MFP breast cancer cell proteomes. 231MFP proteomes were pre-incubated with DMSO or nimbolide (10 μM, 30 min) prior to labeling with the nimbolide-alkyne probe (1 μM, 1 h), followed by CuAAC-appendage of rhodamine-azide, SDS/PAGE, and analysis of in-gel fluorescence. Nimbolide-competed bands correspond to the molecular weights of PTOV1 and RNF114. ( FIG. 10 D ) Gel-based ABPP analysis of pure human RNF114 protein labeled with nimbolide probe. In the upper two panels, pure RNF114 protein was pre-incubated with DMSO vehicle or nimbolide (100 μM, 30 min) prior to labeling with the nimbolide probe (10 μM, 1 h) in PBS. In the lower two panels, pure wild-type and C8A mutant RNF114 protein were labeled with the nimbolide probe (10 μM, 1 h) in PBS with 1 mg/ml BSA. For both experiments, shown are nimbolide-alkyne labeling and silver staining of RNF114. ( FIG. 10 E ) Pure RNF114 protein was labeled with nimbolide (100 μM, 1 h) and subjected to tryptic digestion and LC-MS/MS analysis. Shown is the nimbolide-modified adduct on C8 of RNF114. Peptide sequence corresponds to residues 7-26 of SEQ ID NO:2. Data shown in ( FIGS. 10 C- 10 D ) are from n=3/group.

FIGS. 11 A- 11 D . Nimbolide inhibits RNF114 activity through disrupting substrate recognition. ( FIG. 11 A ) RNF114 ubiquitination assay with pure GST-Ube1, GST-UBE2D1, and RNF114 protein, Flag-Ubiquitin and ATP with or without addition of p21 and blotting against Flag-ubiquitin (left) or p21 (right). DMSO or Nimbolide (100 μM) was pre-incubated with RNF114, before the addition of the E1 and E2 enzymes, Flag-ubiquitin and ATP to start the reaction. ( FIG. 11 B ) RNF114 autoubiquitination assay with DMSO or nimbolide (100 M) treatment with wild-type or C8A mutant RNF114. ( FIG. 11 C ) In an in vitro incubation of pure RNF114 and p21 protein, Flag-RNF114 pulldown and p21 enrichment was inhibited by nimbolide (100 μM). D) 231MFP cells were treated with nimbolide (100 μM). Shown are p21 levels in DMSO control or nimbolide-treated cells. Gels shown in ( FIGS. 11 A- 11 D ) are representative images from n=3/group. Data shown in ( FIG. 11 C ) are average±sem. Data shown in ( FIG. 11 C ) are from n=3/group. Significance in ( FIG. 11 C ) is expressed as *p<0.05 compared to the p21/RNF114 group in ( FIG. 11 C ) or against vehicle-treated control groups for each time point in ( FIG. 11 D ).

FIGS. 12 A- 12 G . Nimbolide can be used to recruit RNF114 for targeted protein degradation of BRD4. ( FIG. 12 A ) Route for synthesizing XH1 and XH2, nimbolide-based degraders consisting of nimbolide as an RNF114 recruiter, linkers, and the BRD4 inhibitor JQ1. ( FIGS. 12 B, 12 C ) BRD4 levels in 231MFP breast cancer cells pre-treated with DMSO vehicle or proteasome inhibitor bortezomib (BTZ) (1 μM) 30 min prior to and also during treatment with XH1 ( FIG. 12 B ) or XH2 ( FIG. 12 C ) treatment (100 nM) for 12 h. ( FIG. 12 D ) BRD4 levels in 231MFP breast cancer cells treated with MZ1 versus XH2 treatment for 12 h. ( FIGS. 12 E- 12 G ) BRD4 levels in 231MFP breast cancer cells pre-treated with DMSO vehicle or E3 ligase inhibitor TAK-243 (10 μM) (E), JQ1 (1 μM) (F), or emetine (75 μM) ( FIG. 12 G ) for 30 min prior to and also during XH2 treatment (100 nM) for 12 h. Long and short BRD4 isoforms and GAPDH loading controls were visualized by SDS/PAGE and Western blotting and quantified by densitometry in ( FIGS. 12 B- 12 G ). Gels shown in (B-G) are representative images from n=3/group. Data shown in (B, C, E-G) are average±sem. Significance in ( FIGS. 12 B, 12 C, 12 E- 12 G ) is expressed as *p<0.05 compared to the vehicle-treated control groups and #p<0.05 compared to XH2-treated groups.

FIGS. 13 A- 13 F . Chemoproteomics-enabled covalent ligand screening to identify more synthetically tractable covalent ligands against RNF114. ( FIG. 13 A ) Gel-based ABPP analysis of nimbolide competition against IA-alkyne (10 μM) or JNS27 (50 μM) labeling of pure RNF114 protein. Structures of IA-alkyne and JNS27 probes are shown with reactive moieties highlighted in red. Shown also is gel-based ABPP analysis of nimbolide (50 μM) competition against JNS27 labeling of wild-type and C8A mutant RNF114 protein. In these experiments, DMSO or nimbolide was pre-incubated for 30 min prior to probe labeling for 1 h. ( FIG. 13 B ) Upon screening a library of cysteine-reactive covalent ligands against JNS27 labeling of RNF114, EN62 was one of the top hits. Shown is the structure of EN62 with the acrylamide reactive moiety highlighted in red. Shown also is a gel-based ABPP analysis of EN62 against JNS27 labeling of pure RNF114. ( FIG. 13 C ) RNF114 autoubiquitination assay with DMSO or EN62 (50 μM) treatment with wild-type or C8A mutant RNF114. ( FIG. 13 D ) IsoTOP-ABPP analysis of EN62 in 231MFP breast cancer cell proteomes in vitro. DMSO or EN62 (50 μM) were pre-incubated with 231MFP proteomes 30 min prior to IA-alkyne labeling (100 μM) for 1 h, followed by the isoTOP-ABPP method. ( FIG. 13 E ) 231MFP cell survival with EN62 after 48 h assessed by Hoechst stain. ( FIG. 13 F ) 231MFP tumor xenograft growth in C.B-17 female SCID mice treated with vehicle (18:1:1 saline:PEG40:ethanol) or EN62 (50 mg/kg ip, once per day, initiated 17 days after subcutaneous injection of 231MFP cells). Gels shown in ( FIGS. 13 A- 13 C ) are representative images from n=3/group. Data shown in ( FIGS. 13 D, 13 F ) are average±sem, n=3-8/group. Significance in ( FIGS. 13 E- 13 F ) is expressed as *p<0.05 compared to the vehicle-treated controls.

FIG. 14 . PTOV1 and PFKP knockdown in 231MFP breast cancer cells. PTOV1 and PFKP were stably knocked down with shRNA oligonucleotides and expression was confirmed by qPCR. 231MFP shControl cells used shRNA oligonucleotides targeting GFP. 231MFP shControl, shPFKP, and shPTOV1 cell proliferation were assessed after 48 h by Hoechst stain. Data shown are average±sem, n=6/group. Significance is expressed as *p<0.05 compared to shControl cells.

FIG. 15 . Levels of p53 in nimbolide-treated 231MFP breast cancer cells. p53 levels in 231MFP breast cancer cells treated with DMSO vehicle or nimbolide (100 μM) assessed by Western blotting alongside GAPDH levels as a loading control. Gels are representative of an n=3/group. Blots were quantified by densitometry and normalizing to loading control. Data shown in bar graph are average±sem.

FIGS. 16 A- 16 C . Gel-based ABPP screen of cysteine-reactive ligands against RNF114. Cysteine-reactive covalent ligands were screened against JNS27 labeling of pure human RNF114 protein. Covalent ligands (50 μM) were pre-incubated with RNF114 for 30 min prior to labeling with JNS27 for 1 h. Rhodamine-azide was then appended to probe-labeled proteins by CuAAC. Proteins were separated by SDS/PAGE and visualized by in-gel fluorescence. Those proteins that showed inhibition of probe-labeling were re-tested in dose-response studies below to identify hits that reproducibly inhibited JNS27 labeling of RNF114.

FIGS. 17 A- 17 C . Nimbolide impairs breast cancer cell proliferation or survival. ( FIGS. 17 A- 17 B ) 231MFP breast cancer cell proliferation in serum-containing media ( FIG. 17 A ) and serum-free cell survival ( FIG. 17 B ). Data shown in FIGS. 17 A- 17 B are average±sem, n=6 biologically independent samples/group. ( FIG. 17 C ) Percent of propidium iodide and Annexin-V-positive (PI+/Annexin-V+) cells assessed by flow cytometry after treating 231MFP cells with DMSO vehicle or nimbolide for 24 or 48 h. Shown are representative FACS data from n=3 biologically independent samples/group. Quantitation of percentage of late-stage apoptotic cells defined as defined as FITC+/PI+ cells are shown in FIG. 18 D . Statistical significance was calculated with unpaired two-tailed Student's t-tests. Significance is expressed as *p=7.75×10 −14 and 1.14×10 −13 for 100 and 10 μM, respectively in FIG. 17 A and *p=3.88×10 −8 and 1.53×10 −7 for 100 and 10 μM, respectively in FIG. 17 B compared to vehicle-treated controls.

FIGS. 18 A- 18 E . Nimbolide impairs breast cancer cell proliferation and survival and induces apoptosis. ( FIGS. 18 A- 18 B ) HCC38 breast cancer cell proliferation in serum-containing media ( FIG. 18 A ) and serum-free cell survival ( FIG. 18 B ). Cells were treated with DMSO vehicle or nimbolide and cell viability was assessed after 48 h. ( FIG. 18 C ) Shown is the gating strategy for the flow cytometry data. We used two gating steps—the first step we gated by forward and side scatter. The second gate was based on separation into quadrants by cell death stains (PI/annexin). ( FIGS. 18 D- 18 E ) Percent of propidium iodide and Annexin-V-positive (PI+/Annexin-V+) cells assessed by flow cytometry after treating 231MFP ( FIG. 18 D ) and HCC38 ( FIG. 18 E ) cells with DMSO vehicle or nimbolide for 24 or 48 h. Representative FACS data from 231MFP cells in FIG. 18 D in shown in FIG. 17 C and from HCC38 cells are shown in ( FIG. 18 E ) on the left panels. Bar graphs in FIGS. 18 D- 18 E are percentage of late-stage apoptotic cells defined as defined as PI+/Annexin-V+ cells. Data shown in FIGS. 18 A- 18 B and FIGS. 18 D- 18 E are average±sem, n=6 in FIGS. 18 A- 18 B and n=3 in FIGS. 18 D- 18 E biologically independent samples/group. Statistical significance was calculated with unpaired two-tailed Student's t-tests. Significance is expressed as *p=1.64×10 −13 and 2.05×10 −13 for 100 and 10 μM, respectively for FIG. 18 A and *p=2.09×10 −11 and 7.07×10 −12 for 100 and 10 μM, respectively for FIG. 18 B , *p=9.05×10 −5 and 1.87×10 −5 for 10 and 100 μM, respectively for 24 h data for FIG. 18 D , *p=0.00139, 0.000142, and 7.97×10 −9 for 1, 10 and 100 μM, respectively for 48 h data for FIG. 18 E , *p=0.00424, 0.0182, and 2.22×10 −11 for 1, 10 and 100 μM, respectively for 24 h data for FIG. 18 E , and *p=6.68×10 −6 , 4.70×10 −7 , and 9.00×10 −11 for 1, 10 and 100 μM, respectively for 48 h data for FIG. 18 E , compared to vehicle-treated controls.

FIGS. 19 A- 19 D . isoTOP-ABPP analysis of nimbolide in 231MFP breast cancer cell proteomes reveal RNF114 as a target. ( FIG. 19 A ) isoTOP-ABPP analysis of nimbolide (10 μM) in 231MFP breast cancer cells in situ analyzed as described in FIG. 19 A . Light vs heavy isotopic probe-modified peptide ratios are shown in the left plot where the primary target with the highest ratio was C8 of RNF114. Shown on the right is a representative MS1 light vs heavy peak for the probe-modified peptide bearing C8 of RNF114. ( FIG. 19 B ) RNF114 knockdown by short interfering RNA (siRNA) targeting RNF114 validated by Western blotting of RNF114 compared to siControl 231MFP cells. GAPDH expression is shown as a loading control. Shown gel is a representative gel from n=3 biological replicates/group. ( FIG. 19 C ) 231MFP cell proliferation after 24 h in siControl and siRNF114 cells. ( FIG. 19 D ) Nimbolide effects on 231MFP siControl and siRNF114 231MFP breast cancer cells. Nimbolide effects on 231MFP siControl and siRNF114 231MFP breast cancer cells. Cells were treated with DMSO vehicle or nimbolide for 24 h after which proliferation was assessed. Data for siControl or siRNF114 group was normalized to the respective DMSO vehicle control in each group. Individual biologically independent sample data is shown and the lines indicate mean values. Data shown in FIG. 19 C is average±sem. Data shown in FIGS. 19 A- 19 B are from n=3, in FIGS. 18 D- 18 E are from n=5 biologically independent samples/group. Statistical significance in FIGS. 18 D- 18 E was calculated with unpaired two-tailed Student's t-tests. Significance in FIG. 18 D is expressed as *p=4.52×10 −5 compared to siControl cells. Significance in FIG. 18 E is expressed as *p=1.90×10 −5 , 2.72×10 −4 , and 0.00101 for 10, 6, and 3 μM, respectively compared to the corresponding nimbolide treatment concentration from siControl groups.

FIGS. 20 A- 20 D . Elucidating the Role of RNF114 in nimbolide-mediated effects. ( FIG. 20 A ) RNF114 knockdown by 3 independent siRNAs targeting RNF114 validated by Western blotting of RNF114 compared to siControl 231MFP cells. GAPDH expression is shown as a loading control. ( FIG. 20 B ) 231MFP cell proliferation after 24 h in siControl and siRNF114 cells assessed by Hoechst stain. ( FIG. 20 C ) Nimbolide effects on 231MFP siControl and siRNF114 231MFP breast cancer cells. Cells were treated with DMSO vehicle or nimbolide for 24 h after which proliferation was assessed by Hoechst stain. Data for each siControl or siRNF114 group was normalized to the respective DMSO vehicle control in each group. Individual biologically independent sample data is shown and the lines indicate mean values. ( FIG. 20 D ) Gel-based ABPP analysis of nimbolide, JNS27, and iodoacetamide competition against IA-rhodamine labeling of recombinant human RNF114 protein. RNF114 protein was pre-treated with DMSO vehicle or nimbolide, JNS27, or iodoacetamide for 30 min prior to labeling of RNF114 with IA-rhodamine (100 nM) for 30 min. RNF114 IA-rhodamine labeling was assessed by SDS/PAGE and in-gel fluorescence. Data shown are from an n=1 biological replicates. Data shown are from n=3 biologically independent samples/group. Gels shown in FIG. 20 A and FIG. 20 D are representative gels from n=3 biologically independent samples/group. Data shown in FIG. 20 B are average±sem, n=5 for FIG. 20 B biologically independent samples/group. Statistical significance was calculated with unpaired two-tailed Student's t-tests in FIG. 20 B , FIG. 20 C . Significance is expressed in FIG. 20 B as *p=4.52×10 −5 , 0.0429, and 0.00230 for siRNF114-1, siRNF114-2, and siRNF114-3, respectively compared to siControl cells. Significance in FIG. 20 C is expressed as *p=1.90×10 −5 , 0.000272, 0.00101 for 10, 6, and 3 μM, respectively for siRNF114-1; *p=0.000626, 0.00139, 3.66×10 −5 for 10, 6, and 3 μM, respectively for siRNF114-2; and *p=0.00134, 9.15×10 −5 , 0.00769 for 10, 6, and 3 μM, respectively for siRNF114-3 compared to corresponding concentration of nimbolide treatment in siControl cells. Significance in FIG. 20 F is expressed as *p=0.0188 compared to vehicle-treated controls.

FIGS. 21 A- 21 G . Nimbolide reacts covalently with C8 of RNF114. ( FIG. 21 A ) Nimbolide targets an intrinsically disordered region within RNF114 as assessed by PONDR. ( FIG. 21 B ) Route for synthesis of the alkyne-functionalized nimbolide probe. ( FIG. 21 C ) Gel-based ABPP analysis of pure human RNF114 protein labeled with nimbolide probe. In the upper two panels, pure RNF114 protein was pre-incubated with DMSO vehicle or nimbolide (100 μM, 30 min) prior to labeling with the nimbolide probe (10 μM, 1 h) in PBS. In the lower two panels, pure wild-type and C8A mutant RNF114 protein were labeled with the nimbolide probe (10 μM, 1 h) in PBS with 1 mg/ml BSA. ( FIG. 21 D ) Gel-based ABPP analysis of nimbolide competition against IA-alkyne (10 μM) or JNS27 (50 μM) labeling of pure RNF114 protein. Structures of IA-alkyne and JNS27 probes are shown with reactive moieties highlighted in red. Shown also is gel-based ABPP analysis of nimbolide (50 μM) competition against JNS27 labeling of wild-type and C8A mutant RNF114 protein. In these experiments, DMSO or nimbolide was pre-incubated for 30 min prior to probe labeling for 1 h. ( FIG. 21 E ) Nimbolide-alkyne labeling of Flag-RNF114 in 231MFP cells. 231MFP cells stably expressing a Flag-tagged RNF114 were treated with DMSO vehicle or nimbolide-alkyne for 2 h. RNF114 was subsequently enriched from harvested cell lysates and then rhodamine-azide was appended onto probe-labeled proteins by CuAAC, after which nimbolide-alkyne labeling was visualized by SDS/PAGE and in-gel fluorescence. ( FIG. 21 F ) Nimbolide-alkyne labeling of endogenous RNF114 in 231MFP cells. 231MFP cells were treated with DMSO vehicle or nimbolide-alkyne (50 μM) for 1.5 h. Biotin-azide was appended to probe-labeled proteins by CuAAC, and these proteins were subsequently avidin-enriched. Resulting pulled down proteins were analyzed by SDS/PAGE and Western blotting for RNF114. Gels shown in FIGS. 21 C- 21 F are representative gels from n=3 biologically independent samples/group.

FIGS. 22 A- 22 I . Nimbolide inhibits RNF114 activity through disrupting substrate recognition. ( FIGS. 22 A- 22 B ) RNF114 ubiquitination assay with pure GST-Ube1, GST-UBE2D1, and RNF114 protein, Flag-Ubiquitin and ATP with or without addition of p21 and blotting against Flag-ubiquitin ( FIG. 22 A ) or p21 ( FIG. 22 B ). ( FIG. 22 C ) RNF114 autoubiquitination assay with DMSO or nimbolide (100 μM) treatment with wild-type or C8A mutant RNF114. ( FIG. 22 D ) In an in vitro incubation of pure RNF114 and p21 protein, Flag-RNF114 pulldown and p21 enrichment were inhibited by nimbolide (100 μM). ( FIG. 22 E ) 231MFP cells were treated with nimbolide (100 μM). Shown are p21 levels in DMSO control or nimbolide-treated cells. ( FIG. 22 F ) Tandem mass tag (TMT)-based quantitative proteomic profiling of 231MFP breast cancer cells treated with DMSO vehicle or nimbolide (100 nM) for 12 h. Shown in red are proteins that are significantly heightened in levels >2-fold. Data shown in ( FIG. 22 F ) are for 6397 proteins quantified with 2 or more unique peptides in n=3 biologically independent samples/group. ( FIG. 22 G ) RNF114 ubiquitination assay with pure GST-Ube1, GST-UBE2D1, and RNF114 protein, Flag-Ubiquitin and ATP with the addition of p21 (CDKN1A), PEG10, or CTGF and blotting against Flag-ubiquitin. DMSO or Nimbolide (100 μM) was pre-incubated with RNF114, before the addition of the E1 and E2 enzymes, Flag-ubiquitin and ATP to start the reaction. ( FIG. 22 H ) p21 (CDKN1A) and p57 (CDKN1C) expression in siControl and siCDKN1A/siCDKN1C 231MFP cells, assessed by Western blotting, alongside actin as a loading control. ( FIG. 22 I ) 231MFP cell proliferation in siControl or siCDKN1A/siCDKN1C cells treated with DMSO vehicle or nimbolide (6 μM) for 24 h. Gels shown in FIGS. 22 A- 22 E and FIG. 22 G are representative images from n=3 biologically independent samples/group. Quantification for blots shown in FIGS. 22 A- 22 D are in FIGS. 23 A- 23 D . All three biologically independent samples/group are shown in FIG. 22 H . Data shown in FIG. 22 I are average±sem, n=5 biologically independent samples/group. Statistical significance was calculated with unpaired two-tailed Student's t-tests in FIG. 22 E and FIG. 22 I . Significance is expressed as *p=000799, 0.0295, 0.00962, and 0.0135 for 1, 2, 4, and 8 h, respectively compared to vehicle-treated control groups for each time point in FIG. 22 E , and p=5.65×10 −8 and 0.0173 compared to vehicle-treated siControl and siCDKN1A/siCDKN1C groups, respectively in FIG. 22 I . Significance expressed as #p=6.70×10 −5 compared to nimbolide-treated siControl cells in FIG. 22 I .

FIGS. 23 A- 23 I . Nimbolide can be used to recruit RNF114 for targeted protein degradation of BRD4. ( FIG. 23 A ) Route for synthesizing XH2, a nimbolide-based degrader consisting of nimbolide as an RNF114 recruiter, a linker, and the BRD4 inhibitor JQ1. ( FIG. 23 B ) Gel-based ABPP analysis of XH2 against RNF114. RNF114 was pre-incubated with DMSO vehicle or XH2 for 30 min prior to JNS27 labeling (50 μM) for 1 h followed by appending rhodamine-azide by CuAAC, SDS/PAGE, and analysis of in-gel fluorescence. ( FIGS. 23 C- 23 D ) BRD4 expression in 231MFP breast cancer cells treated with XH2 ( FIG. 23 C ) versus MZ1 ( FIG. 23 D ) treatment for 12 h. ( FIGS. 23 E- 23 F ) BRD4 expression in 231MFP breast cancer cells. Cells were pre-treated with DMSO vehicle or proteasome inhibitor bortezomib (BTZ) (1 μM) ( FIG. 23 E ) or E1 ubiquitin activating enzyme inhibitor TAK-243 (10 μM) ( FIG. 23 F ) 30 min prior to and also during treatment with MZ1 (1 μM) or XH2 (100 nM) treatment (100 nM) for 12 h. ( FIG. 24 G ) RNF114 and loading control GAPDH expression in RNF114 wild-type (WT) and knockout (KO) HAP1 cells. ( FIG. 23 H ) RNF114 and BRD4 expression in RNF114 wild-type (WT) or knockout (KO) HAP1 cells treated with DMSO vehicle, MZ1 (1 μM), or XH2 (100 nM) for 12 h. ( FIG. 23 I ) Tandem mass tag (TMT)-based quantitative proteomic profiling of 231MFP breast cancer cells treated with DMSO vehicle or XH2 (100 nM) for 12 h. Long and short BRD4 isoforms in FIGS. 23 C- 23 H were visualized by SDS/PAGE and Western blotting, quantified by densitometry, and normalized to GAPDH loading controls. Gels shown in FIGS. 23 B- 23 H are representative images from n=3 biologically independent samples/group and quantification for blots in FIGS. 23 C- 23 F and FIG. 23 H are shown in FIGS. 25 C- 25 F and FIG. 25 I . Data shown in FIG. 23 I are for 5797 proteins quantified with 2 or more unique peptides in triplicate treatments. Statistical significance in FIG. 23 I are described in the methods section.

I. Definitions

The abbreviations used herein have their conventional meaning within the chemical and biological arts. The chemical structures and formulae set forth herein are constructed according to the standard rules of chemical valency known in the chemical arts.

Where substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., —CH 2 O— is equivalent to —OCH 2 —.

The term “alkyl,” by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include mono-, di- and multivalent radicals. The alkyl may include a designated number of carbons (e.g., C 1 -C 10 means one to ten carbons). Alkyl is an uncyclized chain. An unsaturated alkyl group is one having one or more double bonds or triple bonds. An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (—O—). An alkyl moiety may be an alkenyl moiety. An alkyl moiety may be an alkynyl moiety. An alkyl moiety may be fully saturated. An alkenyl may include more than one double bond and/or one or more triple bonds in addition to the one or more double bonds. An alkynyl may include more than one triple bond and/or one or more double bonds in addition to the one or more triple bonds. The term “alkylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl. The term “alkenylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkene.

The term “heteroalkyl,” by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, including at least one carbon atom and at least one heteroatom (e.g., O, N, P, Si, and S), and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized. The heteroatom(s) (e.g., O, N, S, Si, or P) may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Heteroalkyl is an uncyclized chain. A heteroalkyl moiety may include one heteroatom (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include two optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include three optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include four optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include five optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include up to 8 optionally different heteroatoms (e.g., O, N, S, Si, or P). The term “heteroalkenyl,” by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one double bond. A heteroalkenyl may optionally include more than one double bond and/or one or more triple bonds in additional to the one or more double bonds. The term “heteroalkynyl,” by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one triple bond. A heteroalkynyl may optionally include more than one triple bond and/or one or more double bonds in additional to the one or more triple bonds.

Similarly, the term “heteroalkylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl. For heteroalkylene groups, heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula —C(O) 2 R′— represents both —C(O) 2 R′- and —R′C(O) 2 —. Where “heteroalkyl” is recited, followed by recitations of specific heteroalkyl groups, such as —NR′R″ or the like, it will be understood that the terms heteroalkyl and —NR′R″ are not redundant or mutually exclusive. Rather, the specific heteroalkyl groups are recited to add clarity. Thus, the term “heteroalkyl” should not be interpreted herein as excluding specific heteroalkyl groups, such as —NR′R″ or the like.

The terms “cycloalkyl” and “heterocycloalkyl,” by themselves or in combination with other terms, mean, unless otherwise stated, cyclic versions of “alkyl” and “heteroalkyl,” respectively. Cycloalkyl and heterocycloalkyl are not aromatic. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. A “cycloalkylene” and a “heterocycloalkylene,” alone or as part of another substituent, means a divalent radical derived from a cycloalkyl and heterocycloalkyl, respectively.

In embodiments, the term “cycloalkyl” means a monocyclic, bicyclic, or a multicyclic cycloalkyl ring system. In embodiments, monocyclic ring systems are cyclic hydrocarbon groups containing from 3 to 8 carbon atoms, where such groups can be saturated or unsaturated, but not aromatic. In embodiments, cycloalkyl groups are fully saturated. In embodiments, bridged monocyclic rings contain a monocyclic cycloalkyl ring where two non adjacent carbon atoms of the monocyclic ring are linked by an alkylene bridge of between one and three additional carbon atoms (i.e., a bridging group of the form (CH 2 ) w , where w is 1, 2, or 3). In embodiments, the bridged or fused bicyclic cycloalkyl is attached to the parent molecular moiety through any carbon atom contained within the monocyclic cycloalkyl ring. In embodiments, the multicyclic cycloalkyl is attached to the parent molecular moiety through any carbon atom contained within the base ring.

In embodiments, a cycloalkyl is a cycloalkenyl. The term “cycloalkenyl” is used in accordance with its plain ordinary meaning. In embodiments, a cycloalkenyl is a monocyclic, bicyclic, or a multicyclic cycloalkenyl ring system. In embodiments, monocyclic cycloalkenyl ring systems are cyclic hydrocarbon groups containing from 3 to 8 carbon atoms, where such groups are unsaturated (i.e., containing at least one annular carbon carbon double bond), but not aromatic. In embodiments, bicyclic cycloalkenyl rings are bridged monocyclic rings or a fused bicyclic rings. In embodiments, bridged monocyclic rings contain a monocyclic cycloalkenyl ring where two non adjacent carbon atoms of the monocyclic ring are linked by an alkylene bridge of between one and three additional carbon atoms (i.e., a bridging group of the form (CH 2 ) w , where w is 1, 2, or 3). In embodiments, the bridged or fused bicyclic cycloalkenyl is attached to the parent molecular moiety through any carbon atom contained within the monocyclic cycloalkenyl ring. In embodiments, the multicyclic cycloalkenyl is attached to the parent molecular moiety through any carbon atom contained within the base ring.

In embodiments, a heterocycloalkyl is a heterocyclyl. The term “heterocyclyl” as used herein, means a monocyclic, bicyclic, or multicyclic heterocycle. The heterocyclyl monocyclic heterocycle is a 3, 4, 5, 6 or 7 membered ring containing at least one heteroatom independently selected from the group consisting of O, N, and S where the ring is saturated or unsaturated, but not aromatic. The 3 or 4 membered ring contains 1 heteroatom selected from the group consisting of O, N and S. The 5 membered ring can contain zero or one double bond and one, two or three heteroatoms selected from the group consisting of O, N and S. The 6 or 7 membered ring contains zero, one or two double bonds and one, two or three heteroatoms selected from the group consisting of O, N and S. The heterocyclyl monocyclic heterocycle is connected to the parent molecular moiety through any carbon atom or any nitrogen atom contained within the heterocyclyl monocyclic heterocycle. The heterocyclyl bicyclic heterocycle is connected to the parent molecular moiety through any carbon atom or any nitrogen atom contained within the monocyclic heterocycle portion of the bicyclic ring system. The multicyclic heterocyclyl is attached to the parent molecular moiety through any carbon atom or nitrogen atom contained within the base ring.

The terms “halo” or “halogen,” by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as “haloalkyl” are meant to include monohaloalkyl and polyhaloalkyl. For example, the term “halo(C 1 -C 4 )alkyl” includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.

The term “acyl” means, unless otherwise stated, —C(O)R where R is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

The term “aryl” means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring. The term “heteroaryl” refers to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. Thus, the term “heteroaryl” includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring). A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. An “arylene” and a “heteroarylene,” alone or as part of another substituent, mean a divalent radical derived from an aryl and heteroaryl, respectively. A heteroaryl group substituent may be —O— bonded to a ring heteroatom nitrogen.

Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom. The individual rings within spirocyclic rings may be identical or different. Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings. Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g. substituents for cycloalkyl or heterocycloalkyl rings). When referring to a spirocyclic ring system, heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring. When referring to a spirocyclic ring system, substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.

The symbol “ ” denotes the point of attachment of a chemical moiety to the remainder of a molecule or chemical formula.

The term “oxo,” as used herein, means an oxygen that is double bonded to a carbon atom.

Each of the above terms (e.g., “alkyl,” “heteroalkyl,” “cycloalkyl,” “heterocycloalkyl,” “aryl,” and “heteroaryl”) includes both substituted and unsubstituted forms of the indicated radical. Preferred substituents for each type of radical are provided below.

Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to, —OR′, ═O, ═NR′, ═N—OR′, —NR′R″, —SR′, -halogen, —SiR′R″R′″, —OC(O)R′, —C(O)R′, —CO 2 R′, —CONR′R″, —OC(O)NR′R″, —NR″C(O)R′, —NR′—C(O)NR″R′″, —NR″C(O) 2 R′, —NR—C(NR′R″R′″)═NR″″, —NR—C(NR′R″)═NR′, —S(O)R′, —S(O) 2 R′, —S(O) 2 NR′R″, —NRSO 2 R′, —NR′NR″R′″, —ONR′R″, —NR′C(O)NR″NR′″R″″, —CN, —NO 2 , —NR′SO 2 R″, —NR′C(O)R″, —NR′C(O)—OR″, —NR′OR″, in a number ranging from zero to (2m′+1), where m′ is the total number of carbon atoms in such radical. R, R′, R″, R′″, and R″″ each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R′, R″, R′″, and R″″ group when more than one of these groups is present. When R′ and R″ are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7-membered ring. From the above discussion of substituents, one of skill in the art will understand that the term “alkyl” is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., —CF 3 and —CH 2 CF 3 ) and acyl (e.g., —C(O)CH 3 , —C(O)CF 3 , —C(O)CH 2 OCH 3 , and the like).

Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are varied and are selected from, for example: —OR′, —NR′R″, —SR′, -halogen, —SiR′R″R′″, —OC(O)R′, —C(O)R′, —CO 2 R′, —CONR′R″, —OC(O)NR′R″, —NR″C(O)R′, —NR′—C(O)NR″R′″, —NR″C(O) 2 R′, —NR—C(NR′R″R′″)═NR″″, —NR—C(NR′R″)═NR′, —S(O)R′, —S(O) 2 R′, —S(O) 2 NR′R″, —NRSO 2 R′, —NR′NR″R′″, —ONR′R″, —NR′C(O)NR″NR′″R″″, —CN, —NO 2 , —R′, —N 3 , —CH(Ph) 2 , fluoro(C 1 -C 4 )alkoxy, and fluoro(C 1 -C 4 )alkyl, —NR′SO 2 R″, —NR′C(O)R″, —NR′C(O)—OR″, —NR′OR″, in a number ranging from zero to the total number of open valences on the aromatic ring system; and where R′, R″, R′″, and R″″ are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R′, R″, R′″, and R″″ groups when more than one of these groups is present.

Substituents for rings (e.g. cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene) may be depicted as substituents on the ring rather than on a specific atom of a ring (commonly referred to as a floating substituent). In such a case, the substituent may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings). When a substituent is attached to a ring, but not a specific atom (a floating substituent), and a subscript for the substituent is an integer greater than one, the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different. Where a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent), the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency. Where a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms. Where the ring heteroatoms are shown bound to one or more hydrogens (e.g. a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.

Two or more substituents may optionally be joined to form aryl, heteroaryl, cycloalkyl, or heterocycloalkyl groups. Such so-called ring-forming substituents are typically, though not necessarily, found attached to a cyclic base structure. In one embodiment, the ring-forming substituents are attached to adjacent members of the base structure. For example, two ring-forming substituents attached to adjacent members of a cyclic base structure create a fused ring structure. In another embodiment, the ring-forming substituents are attached to a single member of the base structure. For example, two ring-forming substituents attached to a single member of a cyclic base structure create a spirocyclic structure. In yet another embodiment, the ring-forming substituents are attached to non-adjacent members of the base structure.

As used herein, the terms “heteroatom” or “ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), and silicon (Si).

A “substituent group,” as used herein, means a group selected from the following moieties:

(A) oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and (B) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from:

(i) oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and (ii) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from:

(a) oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and (b) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from: oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl).

In embodiments, a “substituent group,” as used herein, means a group selected from the following moieties:

(A) oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and (B) alkyl (e.g., C 1 -C 20 , C 1 -C 12 , C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), cycloalkyl (e.g., C 3 -C 10 , C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), aryl (e.g., C 6 -C 12 , C 6 -C 10 , or phenyl), or heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), substituted with at least one substituent selected from:

(i) oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and (ii) alkyl (e.g., C 1 -C 20 , C 1 -C 12 , C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), cycloalkyl (e.g., C 3 -C 10 , C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), aryl (e.g., C 6 -C 12 , C 6 -C 10 , or phenyl), or heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), substituted with at least one substituent selected from:

(a) oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl), and (b) alkyl (e.g., C 1 -C 20 , C 1 -C 12 , C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), heteroalkyl (e.g., 2 to 20 membered, 2 to 12 membered, 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), cycloalkyl (e.g., C 3 -C 10 , C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), heterocycloalkyl (e.g., 3 to 10 membered, 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), aryl (e.g., C 6 -C 12 , C 6 -C 10 , or phenyl), or heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), substituted with at least one substituent selected from: oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , unsubstituted alkyl (e.g., C 1 -C 8 alkyl, C 1 -C 6 alkyl, or C 1 -C 4 alkyl), unsubstituted heteroalkyl (e.g., 2 to 8 membered heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl), unsubstituted cycloalkyl (e.g., C 3 -C 8 cycloalkyl, C 3 -C 6 cycloalkyl, or C 5 -C 6 cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered heterocycloalkyl, 3 to 6 membered heterocycloalkyl, or 5 to 6 membered heterocycloalkyl), unsubstituted aryl (e.g., C 6 -C 10 aryl, C 10 aryl, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered heteroaryl, 5 to 9 membered heteroaryl, or 5 to 6 membered heteroaryl).

A “size-limited substituent” or “size-limited substituent group,” as used herein, means a group selected from all of the substituents described above for a “substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C 1 -C 20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -C 10 aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl.

A “lower substituent” or “lower substituent group,” as used herein, means a group selected from all of the substituents described above for a “substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C 1 -C 8 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -C 10 aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl.

In other embodiments of the compounds herein, each substituted or unsubstituted alkyl may be a substituted or unsubstituted C 1 -C 20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -C 10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl. In some embodiments of the compounds herein, each substituted or unsubstituted alkylene is a substituted or unsubstituted C 1 -C 20 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 20 membered heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or unsubstituted C 3 -C 8 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 8 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C 6 -C 10 arylene, and/or each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 10 membered heteroarylene.

In some embodiments, each substituted or unsubstituted alkyl is a substituted or unsubstituted C 1 -C 8 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C 3 -C 7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C 6 -C 10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl. In some embodiments, each substituted or unsubstituted alkylene is a substituted or unsubstituted C 1 -C 8 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 8 membered heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or unsubstituted C 3 -C 7 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 7 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C 6 -C 10 arylene, and/or each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 9 membered heteroarylene. In some embodiments, the compound is a chemical species set forth in the Examples section, figures, or tables below.

In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., is an unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, and/or unsubstituted heteroarylene, respectively). In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is substituted (e.g., is a substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene, respectively).

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, wherein if the substituted moiety is substituted with a plurality of substituent groups, each substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of substituent groups, each substituent group is different.

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one size-limited substituent group, wherein if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group is different.

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one lower substituent group, wherein if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group is different.

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group is different.

Certain compounds of the present disclosure possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisomeric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as (D)- or (L)- for amino acids, and individual isomers are encompassed within the scope of the present disclosure. The compounds of the present disclosure do not include those that are known in art to be too unstable to synthesize and/or isolate. The present disclosure is meant to include compounds in racemic and optically pure forms. Optically active (R)- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. When the compounds described herein contain olefinic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.

As used herein, the term “isomers” refers to compounds having the same number and kind of atoms, and hence the same molecular weight, but differing in respect to the structural arrangement or configuration of the atoms.

The term “tautomer,” as used herein, refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another. It will be apparent to one skilled in the art that certain compounds of this disclosure may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the disclosure.

Unless otherwise stated, structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the disclosure. Unless otherwise stated, structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13 C- or 14 C-enriched carbon are within the scope of this disclosure. The compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. For example, the compounds may be radiolabeled with radioactive isotopes, such as for example tritium ( 3 H), iodine-125 ( 125 I), or carbon-14 ( 14 C). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are encompassed within the scope of the present disclosure.

It should be noted that throughout the application that alternatives are written in Markush groups, for example, each amino acid position that contains more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby comprising another embodiment, and the Markush group is not to be read as a single unit.

As used herein, the term “bioconjugate reactive moiety” and “bioconjugate reactive group” refers to a moiety or group capable of forming a bioconjugate (e.g., covalent linker) as a result of the association between atoms or molecules of bioconjugate reactive groups. The association can be direct or indirect. For example, a conjugate between a first bioconjugate reactive group (e.g., —NH2, —COOH, —N-hydroxysuccinimide, or -maleimide) and a second bioconjugate reactive group (e.g., sulfhydryl, sulfur-containing amino acid, amine, amine sidechain containing amino acid, or carboxylate) provided herein can be direct, e.g., by covalent bond or linker (e.g. a first linker of second linker), or indirect, e.g., by non-covalent bond (e.g. electrostatic interactions (e.g. ionic bond, hydrogen bond, halogen bond), van der Waals interactions (e.g. dipole-dipole, dipole-induced dipole, London dispersion), ring stacking (pi effects), hydrophobic interactions and the like). In embodiments, bioconjugates or bioconjugate linkers are formed using bioconjugate chemistry (i.e. the association of two bioconjugate reactive groups) including, but are not limited to nucleophilic substitutions (e.g., reactions of amines and alcohols with acyl halides, active esters), electrophilic substitutions (e.g., enamine reactions) and additions to carbon-carbon and carbon-heteroatom multiple bonds (e.g., Michael reaction, Diels-Alder addition). These and other useful reactions are discussed in, for example, March, ADVANCED ORGANIC CHEMISTRY, 3rd Ed., John Wiley & Sons, New York, 1985; Hermanson, BIOCONJUGATE TECHNIQUES, Academic Press, San Diego, 1996; and Feeney et al., MODIFICATION OF PROTEINS; Advances in Chemistry Series, Vol. 198, American Chemical Society, Washington, D.C., 1982. In embodiments, the first bioconjugate reactive group (e.g., maleimide moiety) is covalently attached to the second bioconjugate reactive group (e.g. a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., haloacetyl moiety) is covalently attached to the second bioconjugate reactive group (e.g. a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., pyridyl moiety) is covalently attached to the second bioconjugate reactive group (e.g. a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., —N-hydroxysuccinimide moiety) is covalently attached to the second bioconjugate reactive group (e.g. an amine). In embodiments, the first bioconjugate reactive group (e.g., maleimide moiety) is covalently attached to the second bioconjugate reactive group (e.g. a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., -sulfo-N-hydroxysuccinimide moiety) is covalently attached to the second bioconjugate reactive group (e.g. an amine).

Useful bioconjugate reactive moieties used for bioconjugate chemistries herein include, for example: (a) carboxyl groups and various derivatives thereof including, but not limited to, N-hydroxysuccinimide esters, N-hydroxybenztriazole esters, acid halides, acyl imidazoles, thioesters, p-nitrophenyl esters, alkyl, alkenyl, alkynyl and aromatic esters; (b) hydroxyl groups which can be converted to esters, ethers, aldehydes, etc. (c) haloalkyl groups wherein the halide can be later displaced with a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion, thereby resulting in the covalent attachment of a new group at the site of the halogen atom; (d) dienophile groups which are capable of participating in Diels-Alder reactions such as, for example, maleimido or maleimide groups; (e) aldehyde or ketone groups such that subsequent derivatization is possible via formation of carbonyl derivatives such as, for example, imines, hydrazones, semicarbazones or oximes, or via such mechanisms as Grignard addition or alkyllithium addition; (f) sulfonyl halide groups for subsequent reaction with amines, for example, to form sulfonamides; (g) thiol groups, which can be converted to disulfides, reacted with acyl halides, or bonded to metals such as gold, or react with maleimides; (h) amine or sulfhydryl groups (e.g., present in cysteine), which can be, for example, acylated, alkylated or oxidized; (i) alkenes, which can undergo, for example, cycloadditions, acylation, Michael addition, etc; (j) epoxides, which can react with, for example, amines and hydroxyl compounds; (k) phosphoramidites and other standard functional groups useful in nucleic acid synthesis; (l) metal silicon oxide bonding; (m) metal bonding to reactive phosphorus groups (e.g. phosphines) to form, for example, phosphate diester bonds; (n) azides coupled to alkynes using copper catalyzed cycloaddition click chemistry; (o) biotin conjugate can react with avidin or strepavidin to form a avidin-biotin complex or streptavidin-biotin complex. The bioconjugate reactive groups can be chosen such that they do not participate in, or interfere with, the chemical stability of the conjugate described herein. Alternatively, a reactive functional group can be protected from participating in the crosslinking reaction by the presence of a protecting group. In embodiments, the bioconjugate comprises a molecular entity derived from the reaction of an unsaturated bond, such as a maleimide, and a sulfhydryl group.

“Analog,” or “analogue” is used in accordance with its plain ordinary meaning within Chemistry and Biology and refers to a chemical compound that is structurally similar to another compound (i.e., a so-called “reference” compound) but differs in composition, e.g., in the replacement of one atom by an atom of a different element, or in the presence of a particular functional group, or the replacement of one functional group by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound. Accordingly, an analog is a compound that is similar or comparable in function and appearance but not in structure or origin to a reference compound.

The terms “a” or “an,” as used in herein means one or more. In addition, the phrase “substituted with a[n],” as used herein, means the specified group may be substituted with one or more of any or all of the named substituents. For example, where a group, such as an alkyl or heteroaryl group, is “substituted with an unsubstituted C 1 -C 20 alkyl, or unsubstituted 2 to 20 membered heteroalkyl,” the group may contain one or more unsubstituted C 1 -C 20 alkyls, and/or one or more unsubstituted 2 to 20 membered heteroalkyls. Moreover, where a moiety is substituted with an R substituent, the group may be referred to as “R-substituted.” Where a moiety is R-substituted, the moiety is substituted with at least one R substituent and each R substituent is optionally different. Where a particular R group is present in the description of a chemical genus (such as Formula (I)), a Roman alphabetic symbol may be used to distinguish each appearance of that particular R group. For example, where multiple R 13 substituents are present, each R 13 substituent may be distinguished as R 13A , R 13B , R 13C , R 13D , etc., wherein each of R 13A , R 13B , R 13C , R 13D , etc. is defined within the scope of the definition of R 13 and optionally differently.

A “detectable agent” or “detectable moiety” is a substance, compound, element, molecule, or composition detectable by appropriate means such as spectroscopic, photochemical, biochemical, immunochemical, chemical, magnetic resonance imaging, or other physical means. For example, useful detectable agents include 18 F, 32 P, 33 P, 45 Ti, 47 Sc, 52 Fe, 59 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 77 As, 86 , 90 Y. 89 Sr, 89 Zr, 94 Tc, 94 Tc, 99m Tc, 99 Mo, 105 Pd, 105 Rh, 111 Ag, 111 In, 123 I, 124 I, 125 I, 131 I, 142 Pr, 143 Pr, 149 Pm, 153 Sm, 154-158 Gd, 161 Tb, 166 Dy, 166 Ho, 169 Er, 175 Lu, 177 Lu, 186 Re, 188 Re, 189 Re, 194 Ir, 198 Au, 199 Au, 211 At, 211 Pb, 212 Bi, 212 Pb, 213 Bi, 223 Ra, 225 Ac, Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, 32 P, fluorophore (e.g. fluorescent dyes), electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, paramagnetic molecules, paramagnetic nanoparticles, ultrasmall superparamagnetic iron oxide (“USPIO”) nanoparticles, USPIO nanoparticle aggregates, superparamagnetic iron oxide (“SPIO”) nanoparticles, SPIO nanoparticle aggregates, monochrystalline iron oxide nanoparticles, monochrystalline iron oxide, nanoparticle contrast agents, liposomes or other delivery vehicles containing Gadolinium chelate (“Gd-chelate”) molecules, Gadolinium, radioisotopes, radionuclides (e.g. carbon-11, nitrogen-13, oxygen-15, fluorine-18, rubidium-82), fluorodeoxyglucose (e.g. fluorine-18 labeled), any gamma ray emitting radionuclides, positron-emitting radionuclide, radiolabeled glucose, radiolabeled water, radiolabeled ammonia, biocolloids, microbubbles (e.g. including microbubble shells including albumin, galactose, lipid, and/or polymers; microbubble gas core including air, heavy gas(es), perfluorcarbon, nitrogen, octafluoropropane, perflexane lipid microsphere, perflutren, etc.), iodinated contrast agents (e.g. iohexol, iodixanol, ioversol, iopamidol, ioxilan, iopromide, diatrizoate, metrizoate, ioxaglate), barium sulfate, thorium dioxide, gold, gold nanoparticles, gold nanoparticle aggregates, fluorophores, two-photon fluorophores, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into a peptide or antibody specifically reactive with a target peptide. A detectable moiety is a monovalent detectable agent or a detectable agent capable of forming a bond with another composition.

Radioactive substances (e.g., radioisotopes) that may be used as imaging and/or labeling agents in accordance with the embodiments of the disclosure include, but are not limited to, 18 F, 32 P, 33 P, 45 Ti, 47 Sc, 52 Fe, 59 Fe, 62 Cu, 64 Cu, 67 Cu, 67 Ga, 68 Ga, 77 As, 86 Y 90 Y. 89 Sr, 89 Zr, 94 Tc, 94 Tc, 99m Tc, 99 Mo, 105 Pd, 105 Rh, 111 Ag, 111 In, 123 I, 124 I, 125 I, 131 I, 142 Pr, 143 Pr, 149 Pm, 153 Sm, 154-1581 Gd, 161 Tb, 166 Dy, 166 Ho, 169 Er, 175 Lu, 177 Lu, 186 Re, 188 Re, 189 Re, 194 Ir, 198 Au, 199 Au, 211 At, 211 Pb, 212 Bi, 212 Pb, 213 Bi, 223 Ra and 225 Ac. Paramagnetic ions that may be used as additional imaging agents in accordance with the embodiments of the disclosure include, but are not limited to, ions of transition and lanthanide metals (e.g. metals having atomic numbers of 21-29, 42, 43, 44, or 57-71). These metals include ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb and Lu.

Descriptions of compounds of the present disclosure are limited by principles of chemical bonding known to those skilled in the art. Accordingly, where a group may be substituted by one or more of a number of substituents, such substitutions are selected so as to comply with principles of chemical bonding and to give compounds which are not inherently unstable and/or would be known to one of ordinary skill in the art as likely to be unstable under ambient conditions, such as aqueous, neutral, and several known physiological conditions. For example, a heterocycloalkyl or heteroaryl is attached to the remainder of the molecule via a ring heteroatom in compliance with principles of chemical bonding known to those skilled in the art thereby avoiding inherently unstable compounds.

A person of ordinary skill in the art will understand when a variable (e.g., moiety or linker) of a compound or of a compound genus (e.g., a genus described herein) is described by a name or formula of a standalone compound with all valencies filled, the unfilled valence(s) of the variable will be dictated by the context in which the variable is used. For example, when a variable of a compound as described herein is connected (e.g., bonded) to the remainder of the compound through a single bond, that variable is understood to represent a monovalent form (i.e., capable of forming a single bond due to an unfilled valence) of a standalone compound (e.g., if the variable is named “methane” in an embodiment but the variable is known to be attached by a single bond to the remainder of the compound, a person of ordinary skill in the art would understand that the variable is actually a monovalent form of methane, i.e., methyl or —CH 3 ). Likewise, for a linker variable (e.g., L 1 , L 2 , or L 3 as described herein), a person of ordinary skill in the art will understand that the variable is the divalent form of a standalone compound (e.g., if the variable is assigned to “PEG” or “polyethylene glycol” in an embodiment but the variable is connected by two separate bonds to the remainder of the compound, a person of ordinary skill in the art would understand that the variable is a divalent (i.e., capable of forming two bonds through two unfilled valences) form of PEG instead of the standalone compound PEG).

The term “pharmaceutically acceptable salts” is meant to include salts of the active compounds that are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein. When compounds of the present disclosure contain relatively acidic functionalities, base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt. When compounds of the present disclosure contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, oxalic, methanesulfonic, and the like. Also included are salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al., “Pharmaceutical Salts”, Journal of Pharmaceutical Science, 1977, 66, 1-19). Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts. Thus, the compounds of the present disclosure may exist as salts, such as with pharmaceutically acceptable acids. The present disclosure includes such salts. Non-limiting examples of such salts include hydrochlorides, hydrobromides, phosphates, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, proprionates, tartrates (e.g., (+)-tartrates, (−)-tartrates, or mixtures thereof including racemic mixtures), succinates, benzoates, and salts with amino acids such as glutamic acid, and quaternary ammonium salts (e.g. methyl iodide, ethyl iodide, and the like). These salts may be prepared by methods known to those skilled in the art. The neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner. The parent form of the compound may differ from the various salt forms in certain physical properties, such as solubility in polar solvents.

In addition to salt forms, the present disclosure provides compounds, which are in a prodrug form. Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present disclosure. Prodrugs of the compounds described herein may be converted in vivo after administration. Additionally, prodrugs can be converted to the compounds of the present disclosure by chemical or biochemical methods in an ex vivo environment, such as, for example, when contacted with a suitable enzyme or chemical reagent.

Certain compounds of the present disclosure can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present disclosure. Certain compounds of the present disclosure may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present disclosure and are intended to be within the scope of the present disclosure.

“Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present disclosure without causing a significant adverse toxicological effect on the patient. Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer's, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like. Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the disclosure. One of skill in the art will recognize that other pharmaceutical excipients are useful in the present disclosure.

The term “preparation” is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it. Similarly, cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.

As used herein, the term “about” means a range of values including the specified value, which a person of ordinary skill in the art would consider reasonably similar to the specified value. In embodiments, about means within a standard deviation using measurements generally acceptable in the art. In embodiments, about means a range extending to +/−10% of the specified value. In embodiments, about includes the specified value.

“Contacting” is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g. chemical compounds including biomolecules or cells) to become sufficiently proximal to react, interact or physically touch. It should be appreciated; however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents that can be produced in the reaction mixture. The term “contacting” may include allowing two species to react, interact, or physically touch, wherein the two species may be a compound as described herein and a protein or enzyme. In some embodiments contacting includes allowing a compound described herein to interact with a protein or enzyme that is involved in a signaling pathway.

As defined herein, the term “activation”, “activate”, “activating”, “activator” and the like in reference to a protein-inhibitor interaction means positively affecting (e.g. increasing) the activity or function of the protein relative to the activity or function of the protein in the absence of the activator. In embodiments activation means positively affecting (e.g. increasing) the concentration or levels of the protein relative to the concentration or level of the protein in the absence of the activator. The terms may reference activation, or activating, sensitizing, or up-regulating signal transduction or enzymatic activity or the amount of a protein decreased in a disease. Thus, activation may include, at least in part, partially or totally increasing stimulation, increasing or enabling activation, or activating, sensitizing, or up-regulating signal transduction or enzymatic activity or the amount of a protein associated with a disease (e.g., a protein which is decreased in a disease relative to a non-diseased control). Activation may include, at least in part, partially or totally increasing stimulation, increasing or enabling activation, or activating, sensitizing, or up-regulating signal transduction or enzymatic activity or the amount of a protein

The terms “agonist,” “activator,” “upregulator,” etc. refer to a substance capable of detectably increasing the expression or activity of a given gene or protein. The agonist can increase expression or activity 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a control in the absence of the agonist. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or higher than the expression or activity in the absence of the agonist.

As defined herein, the term “inhibition”, “inhibit”, “inhibiting” and the like in reference to a protein-inhibitor interaction means negatively affecting (e.g. decreasing) the activity or function of the protein relative to the activity or function of the protein in the absence of the inhibitor. In embodiments inhibition means negatively affecting (e.g. decreasing) the concentration or levels of the protein relative to the concentration or level of the protein in the absence of the inhibitor. In embodiments inhibition refers to reduction of a disease or symptoms of disease. In embodiments, inhibition refers to a reduction in the activity of a particular protein target. Thus, inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating signal transduction or enzymatic activity or the amount of a protein. In embodiments, inhibition refers to a reduction of activity of a target protein resulting from a direct interaction (e.g. an inhibitor binds to the target protein). In embodiments, inhibition refers to a reduction of activity of a target protein from an indirect interaction (e.g. an inhibitor binds to a protein that activates the target protein, thereby preventing target protein activation).

The terms “inhibitor,” “repressor” or “antagonist” or “downregulator” interchangeably refer to a substance capable of detectably decreasing the expression or activity of a given gene or protein. The antagonist can decrease expression or activity 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more in comparison to a control in the absence of the antagonist. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or lower than the expression or activity in the absence of the antagonist.

The terms “RNF4” and “RING finger protein 4” refers to an E3 ligase protein (including homologs, isoforms, and functional fragments thereof). The term includes any recombinant or naturally-occurring form of RNF4 variants thereof that maintain RNF4 activity (e.g. within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity compared to wildtype RNF4). In embodiments, the RNF4 protein encoded by the RNF4 gene has the amino acid sequence set forth in or corresponding to Entrez 6047, UniProt P78317, RefSeq (protein) NP_002929, RefSeq (protein) NP_001171939, or RefSeq (protein) NP_001171938. In embodiments, the amino acid sequence or nucleic acid sequence is the sequence known at the time of filing of the present application. In embodiments, the RNF4 is a human RNF4, such as a human cancer causing RNF4. In embodiments, RNF4 has the sequence:

(SEQ ID NO: 1)

STECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI.

The terms “RNF114” and “RING finger protein 114” and “ZNF228” and “ZNF313” refers to an E3 ligase protein (including homologs, isoforms, and functional fragments thereof). The term includes any recombinant or naturally-occurring form of RNF4 variants thereof that maintain RNF114 activity (e.g. within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity compared to wildtype RNF114). In embodiments, the RNF114 protein encoded by the RNF4 gene has the amino acid sequence set forth in or corresponding to Entrez 55905, UniProt Q9Y508, or RefSeq (protein) NP_061153. In embodiments, the amino acid sequence or nucleic acid sequence is the sequence known at the time of filing of the present application. In embodiments, the RNF114 is a human RNF114, such as a human cancer causing RNF114. In embodiments, RNF114 has the sequence:

(SEQ ID NO: 2)

FSYDTFVDYDVDEEDMMNQVLQRSIIDQ.

The terms “BRD4” and “bromodomain-containing protein 4” refer to a protein that associates with chromosomes during mitosis and plays a key role in transmission of epigenetic memory across cell divisions and transcription regulation. In embodiments, the BRD4 protein encoded by the BRD4 gene has the amino acid sequence set forth in or corresponding to Entrez 23476, UniProt 060885, RefSeq (protein) NP_001317313.1, RefSeq (protein) NP_055114.1, or RefSeq (protein) NP 490597.1. In embodiments, the amino acid sequence or nucleic acid sequence is the sequence known at the time of filing of the present application. In embodiments, BRD4 has the sequence:

(SEQ ID NO: 3)

SDLLSIFEENLF.

The term “expression” includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion. Expression can be detected using conventional techniques for detecting protein (e.g., ELISA, Western blotting, flow cytometry, immunofluorescence, immunohistochemistry, etc.).

The term “modulator” refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule relative to the absence of the modulator. The term “modulate” is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties. “Modulation” refers to the process of changing or varying one or more properties.

The term “associated” or “associated with” in the context of a substance or substance activity or function associated with a disease means that the disease is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function.

The term “aberrant” as used herein refers to different from normal. When used to describe enzymatic activity or protein function, aberrant refers to activity or function that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non-disease-associated amount (e.g. by administering a compound or using a method as described herein), results in reduction of the disease or one or more disease symptoms.

The term “signaling pathway” as used herein refers to a series of interactions between cellular and optionally extra-cellular components (e.g. proteins, nucleic acids, small molecules, ions, lipids) that conveys a change in one component to one or more other components, which in turn may convey a change to additional components, which is optionally propagated to other signaling pathway components.

In this disclosure, “comprises,” “comprising,” “containing” and “having” and the like can have the meaning ascribed to them in U.S. Patent law and can mean “includes,” “including,” and the like. “Consisting essentially of or “consists essentially” likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.

The terms “disease” or “condition” refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein.

The disease may be a cancer. The disease may be an autoimmune disease. The disease may be an inflammatory disease. The disease may be an infectious disease. In some further instances, “cancer” refers to human cancers and carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, etc., including solid and lymphoid cancers, kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, testicular, glioma, esophagus, and liver cancer, including hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin's lymphomas (e.g., Burkitt's, Small Cell, and Large Cell lymphomas), Hodgkin's lymphoma, leukemia (including AML, ALL, and CML), or multiple myeloma.

As used herein, the term “cancer” refers to all types of cancer, neoplasm or malignant tumors found in mammals (e.g. humans), including leukemias, lymphomas, carcinomas and sarcomas. Exemplary cancers that may be treated with a compound or method provided herein include brain cancer, glioma, glioblastoma, neuroblastoma, prostate cancer, colorectal cancer, pancreatic cancer, Medulloblastoma, melanoma, cervical cancer, gastric cancer, ovarian cancer, lung cancer, cancer of the head, Hodgkin's Disease, and Non-Hodgkin's Lymphomas. Exemplary cancers that may be treated with a compound or method provided herein include cancer of the thyroid, endocrine system, brain, breast, cervix, colon, head & neck, liver, kidney, lung, ovary, pancreas, rectum, stomach, and uterus. Additional examples include, thyroid carcinoma, cholangiocarcinoma, pancreatic adenocarcinoma, skin cutaneous melanoma, colon adenocarcinoma, rectum adenocarcinoma, stomach adenocarcinoma, esophageal carcinoma, head and neck squamous cell carcinoma, breast invasive carcinoma, lung adenocarcinoma, lung squamous cell carcinoma, non-small cell lung carcinoma, mesothelioma, multiple myeloma, neuroblastoma, glioma, glioblastoma multiforme, ovarian cancer, rhabdomyosarcoma, primary thrombocytosis, primary macroglobulinemia, primary brain tumors, malignant pancreatic insulanoma, malignant carcinoid, urinary bladder cancer, premalignant skin lesions, testicular cancer, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial cancer, adrenal cortical cancer, neoplasms of the endocrine or exocrine pancreas, medullary thyroid cancer, medullary thyroid carcinoma, melanoma, colorectal cancer, papillary thyroid cancer, hepatocellular carcinoma, or prostate cancer.

The term “leukemia” refers broadly to progressive, malignant diseases of the blood-forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Leukemia is generally clinically classified on the basis of (1) the duration and character of the disease-acute or chronic; (2) the type of cell involved; myeloid (myelogenous), lymphoid (lymphogenous), or monocytic; and (3) the increase or non-increase in the number abnormal cells in the blood-leukemic or aleukemic (subleukemic). Exemplary leukemias that may be treated with a compound or method provided herein include, for example, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophylic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross' leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leukemia, lymphoblastic leukemia, lymphocytic leukemia, lymphogenous leukemia, lymphoid leukemia, lymphosarcoma cell leukemia, mast cell leukemia, megakaryocytic leukemia, micromyeloblastic leukemia, monocytic leukemia, myeloblastic leukemia, myelocytic leukemia, myeloid granulocytic leukemia, myelomonocytic leukemia, Naegeli leukemia, plasma cell leukemia, multiple myeloma, plasmacytic leukemia, promyelocytic leukemia, Rieder cell leukemia, Schilling's leukemia, stem cell leukemia, subleukemic leukemia, or undifferentiated cell leukemia.

As used herein, the term “lymphoma” refers to a group of cancers affecting hematopoietic and lymphoid tissues. It begins in lymphocytes, the blood cells that are found primarily in lymph nodes, spleen, thymus, and bone marrow. Two main types of lymphoma are non-Hodgkin lymphoma and Hodgkin's disease. Hodgkin's disease represents approximately 15% of all diagnosed lymphomas. This is a cancer associated with Reed-Sternberg malignant B lymphocytes. Non-Hodgkin's lymphomas (NHL) can be classified based on the rate at which cancer grows and the type of cells involved. There are aggressive (high grade) and indolent (low grade) types of NHL. Based on the type of cells involved, there are B-cell and T-cell NHLs. Exemplary B-cell lymphomas that may be treated with a compound or method provided herein include, but are not limited to, small lymphocytic lymphoma, Mantle cell lymphoma, follicular lymphoma, marginal zone lymphoma, extranodal (MALT) lymphoma, nodal (monocytoid B-cell) lymphoma, splenic lymphoma, diffuse large cell B-lymphoma, Burkitt's lymphoma, lymphoblastic lymphoma, immunoblastic large cell lymphoma, or precursor B-lymphoblastic lymphoma. Exemplary T-cell lymphomas that may be treated with a compound or method provided herein include, but are not limited to, cutaneous T-cell lymphoma, peripheral T-cell lymphoma, anaplastic large cell lymphoma, mycosis fungoides, and precursor T-lymphoblastic lymphoma.

The term “sarcoma” generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance. Sarcomas that may be treated with a compound or method provided herein include a chondrosarcoma, fibrosarcoma, lymphosarcoma, melanosarcoma, myxosarcoma, osteosarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms' tumor sarcoma, endometrial sarcoma, stromal sarcoma, Ewing's sarcoma, fascial sarcoma, fibroblastic sarcoma, giant cell sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic multiple pigmented hemorrhagic sarcoma, immunoblastic sarcoma of B cells, lymphoma, immunoblastic sarcoma of T-cells, Jensen's sarcoma, Kaposi's sarcoma, Kupffer cell sarcoma, angiosarcoma, leukosarcoma, malignant mesenchymoma sarcoma, parosteal sarcoma, reticulocytic sarcoma, Rous sarcoma, serocystic sarcoma, synovial sarcoma, or telangiectaltic sarcoma.

The term “melanoma” is taken to mean a tumor arising from the melanocytic system of the skin and other organs. Melanomas that may be treated with a compound or method provided herein include, for example, acral-lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman's melanoma, S91 melanoma, Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, nodular melanoma, subungal melanoma, or superficial spreading melanoma.

The term “carcinoma” refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases. Exemplary carcinomas that may be treated with a compound or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiermoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatinifomi carcinoma, gelatinous carcinoma, giant cell carcinoma, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypernephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, large-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma medullare, medullary carcinoma, melanotic carcinoma, carcinoma molle, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma myxomatodes, nasopharyngeal carcinoma, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prickle cell carcinoma, pultaceous carcinoma, renal cell carcinoma of kidney, reserve cell carcinoma, carcinoma sarcomatodes, schneiderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, or carcinoma villosum.

As used herein, the terms “metastasis,” “metastatic,” and “metastatic cancer” can be used interchangeably and refer to the spread of a proliferative disease or disorder, e.g., cancer, from one organ or another non-adjacent organ or body part. “Metastatic cancer” is also called “Stage IV cancer.”

The terms “treating”, or “treatment” refers to any indicia of success in the therapy or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of degeneration or decline; making the final point of degeneration less debilitating; improving a patient's physical or mental well-being. The treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation. The term “treating” and conjugations thereof, may include prevention of an injury, pathology, condition, or disease. In embodiments, treating is preventing. In embodiments, treating does not include preventing. “Treating” or “treatment” as used herein (and as well-understood in the art) also broadly includes any approach for obtaining beneficial or desired results in a subject's condition, including clinical results. Beneficial or desired clinical results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, diminishment of the extent of a disease, stabilizing (i.e., not worsening) the state of disease, prevention of a disease's transmission or spread, delay or slowing of disease progression, amelioration or palliation of the disease state, diminishment of the reoccurrence of disease, and remission, whether partial or total and whether detectable or undetectable. In other words, “treatment” as used herein includes any cure, amelioration, or prevention of a disease. Treatment may prevent the disease from occurring; inhibit the disease's spread; relieve the disease's symptoms (e.g., ocular pain, seeing halos around lights, red eye, very high intraocular pressure), fully or partially remove the disease's underlying cause, shorten a disease's duration, or do a combination of these things. “Treating” and “treatment” as used herein include prophylactic treatment. Treatment methods include administering to a subject a therapeutically effective amount of an active agent. The administering step may consist of a single administration or may include a series of administrations. The length of the treatment period depends on a variety of factors, such as the severity of the condition, the age of the patient, the concentration of active agent, the activity of the compositions used in the treatment, or a combination thereof. It will also be appreciated that the effective dosage of an agent used for the treatment or prophylaxis may increase or decrease over the course of a particular treatment or prophylaxis regime. Changes in dosage may result and become apparent by standard diagnostic assays known in the art. In some instances, chronic administration may be required. For example, the compositions are administered to the subject in an amount and for a duration sufficient to treat the patient. In embodiments, the treating or treatment is no prophylactic treatment.

The term “prevent” refers to a decrease in the occurrence of disease symptoms in a patient. As indicated above, the prevention may be complete (no detectable symptoms) or partial, such that fewer symptoms are observed than would likely occur absent treatment.

“Patient” or “subject in need thereof” refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein. Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals. In some embodiments, a patient is human.

An “effective amount” is an amount sufficient for a compound to accomplish a stated purpose relative to the absence of the compound (e.g. achieve the effect for which it is administered, treat a disease, reduce enzyme activity, increase enzyme activity, reduce a signaling pathway, or reduce one or more symptoms of a disease or condition). An example of an “effective amount” is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a “therapeutically effective amount.” A “reduction” of a symptom or symptoms (and grammatical equivalents of this phrase) means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s). A “prophylactically effective amount” of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms. The full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations. An “activity decreasing amount,” as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme relative to the absence of the antagonist. A “function disrupting amount,” as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist. The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).

For any compound described herein, the therapeutically effective amount can be initially determined from cell culture assays. Target concentrations will be those concentrations of active compound(s) that are capable of achieving the methods described herein, as measured using the methods described herein or known in the art. As is well known in the art, therapeutically effective amounts for use in humans can also be determined from animal models. For example, a dose for humans can be formulated to achieve a concentration that has been found to be effective in animals. The dosage in humans can be adjusted by monitoring compounds effectiveness and adjusting the dosage upwards or downwards, as described above. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the capabilities of the ordinarily skilled artisan.

The term “therapeutically effective amount,” as used herein, refers to that amount of the therapeutic agent sufficient to ameliorate the disorder, as described above. For example, for the given parameter, a therapeutically effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy can also be expressed as “-fold” increase or decrease. For example, a therapeutically effective amount can have at least a 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more effect over a control.

Dosages may be varied depending upon the requirements of the patient and the compound being employed. The dose administered to a patient, in the context of the present disclosure, should be sufficient to effect a beneficial therapeutic response in the patient over time. The size of the dose also will be determined by the existence, nature, and extent of any adverse side-effects. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. Dosage amounts and intervals can be adjusted individually to provide levels of the administered compound effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.

As used herein, the term “administering” means oral administration, administration as a suppository, topical contact, intravenous, parenteral, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject. Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc. In embodiments, the administering does not include administration of any active agent other than the recited active agent.

“Co-administer” it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies. The compounds provided herein can be administered alone or can be coadministered to the patient. Coadministration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). Thus, the preparations can also be combined, when desired, with other active substances (e.g. to reduce metabolic degradation). The compositions of the present disclosure can be delivered transdermally, by a topical route, or formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.

A “cell” as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA. A cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring. A “stem cell” is a cell characterized by the ability of self-renewal through mitotic cell division and the potential to differentiate into a tissue or an organ. Among mammalian stem cells, embryonic stem cells (ES cells) and somatic stem cells (e.g., HSC) can be distinguished. Embryonic stem cells reside in the blastocyst and give rise to embryonic tissues, whereas somatic stem cells reside in adult tissues for the purpose of tissue regeneration and repair.

“Control” or “control experiment” is used in accordance with its plain ordinary meaning and refers to an experiment in which the subjects or reagents of the experiment are treated as in a parallel experiment except for omission of a procedure, reagent, or variable of the experiment. In some instances, the control is used as a standard of comparison in evaluating experimental effects. In some embodiments, a control is the measurement of the activity of a protein in the absence of a compound as described herein (including embodiments and examples).

“Anti-cancer agent” and “anticancer agent” are used in accordance with their plain ordinary meaning and refers to a composition, compound, drug, antagonist, inhibitor, modulator, peptide, protein, nucleic acid, or molecule having antineoplastic properties or the ability to inhibit the growth or proliferation of cells. In some embodiments, an anti-cancer agent is a chemotherapeutic. In some embodiments, an anti-cancer agent is an agent identified herein having utility in methods of treating cancer. In some embodiments, an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer. Examples of anti-cancer agents include, but are not limited to, anti-androgens (e.g., Casodex, Flutamide, MDV3100, or ARN-509), MEK (e.g., MEK1, MEK2, or MEK1 and MEK2) inhibitors (e.g., XL518, CI-1040, PD035901, selumetinib/AZD6244, GSK1120212/trametinib, GDC-0973, ARRY-162, ARRY-300, AZD8330, PD0325901, U0126, PD98059, TAK-733, PD318088, AS703026, BAY 869766), alkylating agents (e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambucil, meiphalan), ethylenimine and methylmelamines (e.g., hexamethlymelamine, thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine, lomusitne, semustine, streptozocin), triazenes (decarbazine)), anti-metabolites (e.g., 5-azathioprine, leucovorin, capecitabine, fludarabine, gemcitabine, pemetrexed, raltitrexed, folic acid analog (e.g., methotrexate), pyrimidine analogs (e.g., fluorouracil, floxouridine, Cytarabine), purine analogs (e.g., mercaptopurine, thioguanine, pentostatin), etc.), plant alkaloids (e.g., vincristine, vinblastine, vinorelbine, vindesine, podophyllotoxin, paclitaxel, docetaxel, etc.), topoisomerase inhibitors (e.g., irinotecan, topotecan, amsacrine, etoposide (VP16), etoposide phosphate, teniposide, etc.), antitumor antibiotics (e.g., doxorubicin, adriamycin, daunorubicin, epirubicin, actinomycin, bleomycin, mitomycin, mitoxantrone, plicamycin, etc.), platinum-based compounds (e.g., cisplatin, oxaloplatin, carboplatin), anthracenedione (e.g., mitoxantrone), substituted urea (e.g., hydroxyurea), methyl hydrazine derivative (e.g., procarbazine), adrenocortical suppressant (e.g., mitotane, aminoglutethimide), epipodophyllotoxins (e.g., etoposide), antibiotics (e.g., daunorubicin, doxorubicin, bleomycin), enzymes (e.g., L-asparaginase), inhibitors of mitogen-activated protein kinase signaling (e.g. U0126, PD98059, PD184352, PD0325901, ARRY-142886, SB239063, SP600125, BAY 43-9006, wortmannin, or LY294002), mTOR inhibitors, antibodies (e.g., rituxan), 5-aza-2′-deoxycytidine, doxorubicin, vincristine, etoposide, gemcitabine, imatinib (Gleevec®), geldanamycin, 17-N-Allylamino-17-Demethoxygeldanamycin (17-AAG), bortezomib, trastuzumab, anastrozole; angiogenesis inhibitors; antiandrogen, antiestrogen; antisense oligonucleotides; apoptosis gene modulators; apoptosis regulators; arginine deaminase; BCR/ABL antagonists; beta lactam derivatives; bFGF inhibitor; bicalutamide; camptothecin derivatives; casein kinase inhibitors (ICOS); clomifene analogues; cytarabine dacliximab; dexamethasone; estrogen agonists; estrogen antagonists; etanidazole; etoposide phosphate; exemestane; fadrozole; finasteride; fludarabine; fluorodaunorunicin hydrochloride; gadolinium texaphyrin; gallium nitrate; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; immunostimulant peptides; insulin-like growth factor-1 receptor inhibitor; interferon agonists; interferons; interleukins; letrozole; leukemia inhibiting factor; leukocyte alpha interferon; leuprolide+estrogen+progesterone; leuprorelin; matrilysin inhibitors; matrix metalloproteinase inhibitors; MIF inhibitor; mifepristone; mismatched double stranded RNA; monoclonal antibody; mycobacterial cell wall extract; nitric oxide modulators; oxaliplatin; panomifene; pentrozole; phosphatase inhibitors; plasminogen activator inhibitor; platinum complex; platinum compounds; prednisone; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; ras farnesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; ribozymes; signal transduction inhibitors; signal transduction modulators; single chain antigen-binding protein; stem cell inhibitor; stem-cell division inhibitors; stromelysin inhibitors; synthetic glycosaminoglycans; tamoxifen methiodide; telomerase inhibitors; thyroid stimulating hormone; translation inhibitors; tyrosine kinase inhibitors; urokinase receptor antagonists; steroids (e.g., dexamethasone), finasteride, aromatase inhibitors, gonadotropin-releasing hormone agonists (GnRH) such as goserelin or leuprolide, adrenocorticosteroids (e.g., prednisone), progestins (e.g., hydroxyprogesterone caproate, megestrol acetate, medroxyprogesterone acetate), estrogens (e.g., diethlystilbestrol, ethinyl estradiol), antiestrogen (e.g., tamoxifen), androgens (e.g., testosterone propionate, fluoxymesterone), antiandrogen (e.g., flutamide), immunostimulants (e.g., Bacillus Calmette-Guérin (BCG), levamisole, interleukin-2, alpha-interferon, etc.), monoclonal antibodies (e.g., anti-CD20, anti-HER2, anti-CD52, anti-HLA-DR, and anti-VEGF monoclonal antibodies), immunotoxins (e.g., anti-CD33 monoclonal antibody-calicheamicin conjugate, anti-CD22 monoclonal antibody-pseudomonas exotoxin conjugate, etc.), radioimmunotherapy (e.g., anti-CD20 monoclonal antibody conjugated to 111 In, 90 Y, or 131 I, etc.), triptolide, homoharringtonine, dactinomycin, doxorubicin, epirubicin, topotecan, itraconazole, vindesine, cerivastatin, vincristine, deoxyadenosine, sertraline, pitavastatin, irinotecan, clofazimine, 5-nonyloxytryptamine, vemurafenib, dabrafenib, erlotinib, gefitinib, EGFR inhibitors, epidermal growth factor receptor (EGFR)-targeted therapy or therapeutic (e.g., gefitinib (Iressa™), erlotinib (Tarceva™), cetuximab (Erbitux™), lapatinib (Tykerb™), panitumumab (Vectibix™), vandetanib (Caprelsa™), afatinib/BIBW2992, CI-1033/canertinib, neratinib/HKI-272, CP-724714, TAK-285, AST-1306, ARRY334543, ARRY-380, AG-1478, dacomitinib/PF299804, OSI-420/desmethyl erlotinib, AZD8931, AEE788, pelitinib/EKB-569, CUDC-101, WZ8040, WZ4002, WZ3146, AG-490, XL647, PD153035, BMS-599626), sorafenib, imatinib, sunitinib, dasatinib, pyrrolo benzodiazepines (e.g., tomaymycin), carboplatin, CC-1065 and CC-1065 analogs including amino-CBIs, nitrogen mustards (such as chlorambucil and melphalan), dolastatin and dolastatin analogs (including auristatins: e.g., monomethyl auristatin E), anthracycline antibiotics (such as doxorubicin, daunorubicin, etc.), duocarmycins and duocarmycin analogs, enediynes (such as neocarzinostatin and calicheamicins), leptomycin derivatives, maytansinoids and maytansinoid analogs (e.g., mertansine), methotrexate, mitomycin C, taxoids, vinca alkaloids (such as vinblastine and vincristine), epothilones (e.g., epothilone B), camptothecin and its clinical analogs topotecan and irinotecan, or the like.

“Specific”, “specifically”, “specificity”, or the like of a compound refers to the compound's ability to cause a particular action, such as inhibition, to a particular molecular target with minimal or no action to other proteins in the cell.

The term “electrophilic chemical moiety” or “electrophilic moiety” is used in accordance with its plain ordinary chemical meaning and refers to a chemical group (e.g., monovalent chemical group) that is electrophilic.

The term “irreversible covalent bond” is used in accordance with its plain ordinary meaning in the art and refers to the resulting association between atoms or molecules of (e.g., electrophilic chemical moiety and nucleophilic moiety) wherein the probability of dissociation is low. In embodiments, the irreversible covalent bond does not easily dissociate under normal biological conditions. In embodiments, the irreversible covalent bond is formed through a chemical reaction between two species (e.g., electrophilic chemical moiety and nucleophilic moiety).

The term “capable of binding” as used herein refers to a moiety (e.g. a compound as described herein) that is able to measurably bind to a target (e.g., an E3 Ubiquitin ligase binder is capable of forming a covalent bond with a cysteine of an E3 Ubiquitin ligase). In embodiments, where a moiety is capable of binding a target, the moiety is capable of binding with a Kd of less than about 10 μM, 5 μM, 1 μM, 500 nM, 250 nM, 100 nM, 75 nM, 50 nM, 25 nM, 15 nM, 10 nM, 5 nM, 1 nM, or about 0.1 nM.

The term “targeted protein degrader” as used herein refers to an agent (e.g., a compound or composition) that is capable of inducing protein degradation upon the target protein (e.g., the protein of interest). Typically, a targeted protein degrader is capable of recruiting E3 ligases to specific protein targets to ubiquitinate and degrade targets in a proteasome-dependent manner. As functional inhibition of the target is not necessary for degrader efficacy this strategy has the potential to target and degrade any protein in the proteome for which there exists a ligand (e.g., targeted protein binder or targeted protein degrader).

The term “targeted protein binder” refers to a moiety that is capable of binding to a protein (e.g., the targeted protein). In embodiments, the targeted protein binder is a molecule or substance that forms a complex with a protein (e.g., targeted protein). In embodiments, the targeted protein binder is a monovalent form of a molecule or substance that forms a complex with a protein (e.g., targeted protein).

The term “binder linker” refers to a covalent linker which binds a targeted protein binder and E3 Ubiquitin ligase binder.

The term “E3 Ubiquitin ligase binder” as used herein refers to a monovalent agent (e.g., a monovalent compound described herein) that is able to measurably bind to an E3 Ubiquitin ligase (E3 ligase) (e.g., a RNF4 or RNF114). For example, an E3 Ubiquitin ligase binder is a moiety or monovalent form of a compound having the formula:

wherein R 2 , z2, R 1 , z1, L 3 , and R 4 are as described herein;

wherein R 7 , z7, R 5 , R 2 , z2, L 3 , R 4 , R 6 , R 1 , and z1 are as described herein; or

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are described herein.

The term “covalent cysteine modifier moiety” as used herein refers to a monovalent electrophilic moiety that is able to measurably bind to a cysteine amino acid. In embodiments, the covalent cysteine modifier moiety binds via an irreversible covalent bond. In embodiments, the covalent cysteine modifier moiety is capable of binding with a Kd of less than about 10 μM, 5 μM, 1 μM, 500 nM, 250 nM, 100 nM, 75 nM, 50 nM, 25 nM, 15 nM, 10 nM, 5 nM, 1 nM, or about 0.1 nM.

II. Compounds

In an aspect is provided a targeted protein degrader including 1) a targeted protein binder and 2) an E3 Ubiquitin ligase binder, wherein the E3 Ubiquitin ligase is human RNF4 or human RNF114. In embodiments, the E3 Ubiquitin ligase is human RNF4. In embodiments, the E3 Ubiquitin ligase is human RNF114. In embodiments, the E3 Ubiquitin ligase binder is capable of forming a covalent bond with a cysteine of an E3 Ubiquitin ligase. In embodiments, the targeted protein binder and E3 Ubiquitin ligase binder are covalently bonded by a binder linker.

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 is independently halogen, —CX 1 3 , —CHX 1 2 , —CH 2 X 1 , —CN, —OR 1D , —C(O)R 1C , —C(O)—OR 1C , —C(O)NR 1A R 1B , —N(O) m1 , —SO n1 R 1D , —SO v1 NR 1A R 1B , —NR 1A R 1B , —NHC(O)NR 1A R 1B , —NR 1A SO 2 R 1D , —NR 1A C(O)R 1C , —NR 1A C(O)OR 1C , —NR 1A OR 1C , —OCX 1 3 , —OCH 2 X 1 , —OCHX 1 2 , —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 2 is independently halogen, —CX 2 3 , —CHX 2 2 , —CH 2 X 2 , —CN, —OR 2D , —C(O)R 2C , —C(O)—OR 2C , —C(O)NR 2A R 2B , —N(O) m2 , —SO n2 R 2D , —SO v2 NR 2A R 2B , —NR 2A R 2B , —NHC(O)NR 2A R 2B , —NR 2A SO 2 R 2D , —NR 2A C(O)R 2C , —NR 2A C(O)OR 2C , —NR 2A OR 2C , —OCX 2 3 , —OCH 2 X 2 , —OCHX 2 2 , —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. R 3 is independently hydrogen, oxo, halogen, —CX 3 3 , —CHX 3 2 , —CH 2 X 3 , —CN, —OR 3D , —C(O)R 3C , —C(O)—OR 3C , —C(O)NR 3A R 3B , —N(O) m3 , —SO n3 R 3D , —SO v3 NR 3A R 3B , —NR 3A R 3B , —NHC(O)NR 3A R 3B , —NR 3A SO 2 R 3D , —NR 3A C(O)R 3C , —NR 3A C(O)OR 3C , —NR 3A OR 3C , —OCX 3 3 , —OCH 2 X 3 , —OCHX 3 2 , —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker. R 4 is independently hydrogen, oxo, halogen, —CX 4 3 , —CHX 4 2 , —CH 2 X 4 , —CN, —OR 4D , —C(O)R 4C , —C(O)—OR 4C , —C(O)NR 4A R 4B , —N(O) m4 , —SO n4 R 4D , —SO v4 NR 4A R 4B , —NR 4A R 4B , —NHC(O)NR 4A R 4B , —NR 4A SO 2 R 4D , —NR 4A C(O)R 4C , —NR 4A C(O)OR 4C , —NR 4A OR 4C , —OCX 4 3 , —OCH 2 X 4 , —OCHX 4 2 , —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. z1 is an integer from 0 to 4. z2 is an integer from 0 to 5. Each R 1A , R 1B , R 1C , R 1D , R 2A , R 2B , R 2C , R 2D , R 3A , R 3B , R 3C , R 3D , R 4A , R 4B , R 4C , and R 4D is independently hydrogen, —CX 3 , —CN, —COOH, —CONH 2 , —CHX 2 , —CH 2 X, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 1A and R 1B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R 2A and R 2B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R 3A and R 3B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl; R 4A and R 4B substituents bonded to the same nitrogen atom may optionally be joined to form a substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heteroaryl. Each X, X 1 , X 2 , X 3 , and X 4 is independently —F, —Cl, —Br, or —I. n1, n2, n3, and n4 are independently an integer from 0 to 4. m1, m2, m3, m4, v1, v2, v3, and v4 are independently 1 or 2. Only one R 1 or one R 2 or one R 3 is a bond to the binder linker. In embodiments, R 1 is a bond to the binder linker. In embodiments, R 2 is a bond to the binder linker. In embodiments, R 3 is a bond to the binder linker. In embodiments, one R 1 is independently a bond to the binder linker. In embodiments, one R 2 is independently a bond to the binder linker. In embodiments, one R 3 is independently a bond to the binder linker. One R 1 or one R 2 or one R 3 is a bond to the binder linker.

In embodiments, R 3 is independently hydrogen, halogen, —CX 3 3 , —CHX 3 2 , —CH 2 X 3 , —CN, —OR 3 D, —C(O)R 3C , —C(O)—OR 3C , —C(O)NR 3A R 3B , —N(O) m3 , —SO n3 R 3D , —SO v3 NR 3A R 3B , —NR 3A R 3B , —NHC(O)NR 3A R 3B , —NR 3A SO 2 R 3D , —NR 3A C(O)R 3C , —NR 3A C(O)OR 3C , —NR 3A OR 3C , —OCX 3 3 , —OCH 2 X 3 , —OCHX 3 2 , —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker. R 3A , R 3B , R 3C , R 3D , X 3 , n3, m3, and v3 are as described herein, including in embodiments.

In embodiments, R 4 is independently hydrogen, halogen, —CX 4 3 , —CHX 4 2 , —CH 2 X 4 , —CN, —OR 4 D, —C(O)R 4C , —C(O)—OR 4C , —C(O)NR 4A R 4B , —N(O) m4 , —SO n4 R 4D , —SO v4 NR 4A R 4B , —NR 4A R 4B , —NHC(O)NR 4A R 4B , —NR 4A SO 2 R 4D , —NR 4A C(O)R 4C , —NR 4A C(O)OR 4C , —NR 4A OR 4C , —OCX 4 3 , —OCH 2 X 4 , —OCHX 4 2 , —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. R 4A , R 4B , R 4C , R 4D , X 4 , n4, m4, and v4 are as described herein, including in embodiments.

In embodiments, R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. In embodiments, R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments, R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. z1 is an integer from 0 to 4. z2 is an integer from 0 to 5. Only one R 1 or one R 2 is a bond to the binder linker. In embodiments, R 1 is a bond to the binder linker. In embodiments, R 2 is a bond to the binder linker.

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , L 3 , z1, z2, and R 4 are as described herein.

R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker. R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 7 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. The symbol z7 is an integer from 0 to 10. In embodiments, only one R 1 , R 2 , R 5 , R 6 , or R 7 is independently a bond to the binder linker. In embodiments, R 1 is independently a bond to the binder linker. In embodiments, R 2 is independently a bond to the binder linker. In embodiments, R 3 is independently a bond to the binder linker. In embodiments, R 5 is independently a bond to the binder linker. In embodiments, R 6 is independently a bond to the binder linker. In embodiments, R 7 is independently a bond to the binder linker.

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 are as described herein. R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; or a bond to the binder linker. Only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; and

is a single bond or a double bond.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, and z7 are as described herein. R 2w is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker. The symbol z3 is an integer from 0 to 3. Only one R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; and

is a single bond or a double bond.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein.

In embodiments, R 3 is independently a bond to the binder linker. In embodiments, R 8 is independently a bond to the binder linker. In embodiments, R 9 is independently a bond to the binder linker. In embodiments, R 10 is independently a bond to the binder linker.

In embodiments, R 2w is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 21 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 21 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 21 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 21 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 21 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), R 21 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 2w is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 2w (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 2w is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 2w is substituted, it is substituted with at least one substituent group. In embodiments, when R 2w is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 2w is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 2w is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 2w is independently hydrogen. In embodiments, R 2w is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 2w is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 2w is independently unsubstituted methyl. In embodiments, R 2w is independently unsubstituted ethyl. In embodiments, R 2w is independently unsubstituted n-propyl. In embodiments, R 2w is independently unsubstituted isopropyl. In embodiments, R 2w is independently unsubstituted n-butyl. In embodiments, R 2w is independently unsubstituted tert-butyl.

In embodiments, R 3 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 3 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 3 is independently unsubstituted methyl. In embodiments, R 3 is independently unsubstituted ethyl. In embodiments, R 3 is independently unsubstituted n-propyl. In embodiments, R 3 is independently unsubstituted isopropyl. In embodiments, R 3 is independently unsubstituted n-butyl. In embodiments, R 3 is independently unsubstituted tert-butyl.

In embodiments, z3 is 0. In embodiments, z3 is 1. In embodiments, z3 is 2. In embodiments, z3 is 3.

In embodiments, R 7 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 7 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 7 is independently unsubstituted methyl. In embodiments, R 7 is independently unsubstituted ethyl. In embodiments, R 7 is independently unsubstituted n-propyl. In embodiments, R 7 is independently unsubstituted isopropyl. In embodiments, R 7 is independently unsubstituted n-butyl. In embodiments, R 7 is independently unsubstituted tert-butyl.

In embodiments, R 8 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 8 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 8 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 8 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 8 is substituted, it is substituted with at least one substituent group. In embodiments, when R 8 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 8 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 8 is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 8 is independently hydrogen. In embodiments, R 8 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 8 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 8 is independently unsubstituted methyl. In embodiments, R 8 is independently unsubstituted ethyl. In embodiments, R 8 is independently unsubstituted n-propyl. In embodiments, R 8 is independently unsubstituted isopropyl. In embodiments, R 8 is independently unsubstituted n-butyl. In embodiments, R 8 is independently unsubstituted tert-butyl.

In embodiments, R 9 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 9 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 9 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 9 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 9 is substituted, it is substituted with at least one substituent group. In embodiments, when R 9 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 9 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 9 is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 9 is independently hydrogen. In embodiments, R 9 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 9 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 9 is independently unsubstituted methyl. In embodiments, R 9 is independently unsubstituted ethyl. In embodiments, R 9 is independently unsubstituted n-propyl. In embodiments, R 9 is independently unsubstituted isopropyl. In embodiments, R 9 is independently unsubstituted n-butyl. In embodiments, R 9 is independently unsubstituted tert-butyl.

In embodiments, R 10 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 10 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 10 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 10 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 10 is substituted, it is substituted with at least one substituent group. In embodiments, when R 10 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 10 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 10 is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 10 is independently hydrogen. In embodiments, R 10 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 10 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 10 is independently unsubstituted methyl. In embodiments, R 10 is independently unsubstituted ethyl. In embodiments, R 10 is independently unsubstituted n-propyl. In embodiments, R 10 is independently unsubstituted isopropyl. In embodiments, R 10 is independently unsubstituted n-butyl. In embodiments, R 10 is independently unsubstituted tert-butyl.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having a monovalent form of the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having a monovalent form of the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein. In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a moiety of a compound having the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

wherein L 3 and R 4 are as described herein.

In embodiments, R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 1 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 1 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 1 is substituted, it is substituted with at least one substituent group. In embodiments, when R 1 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 1 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 1 -substituted or unsubstituted alkyl (e.g., C 1 -C 9 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 11 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 1 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 11 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 11 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 11 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker; two R 1 substituents may optionally be joined to form an R 11 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 11 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 11 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 11 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 11 -substituted or unsubstituted C 1 -C 8 alkyl, R 11 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 11 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 11 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 11 -substituted or unsubstituted C 6 -C 10 aryl, or R 11 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form an R 11 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 11 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 11 -substituted or unsubstituted C 6 -C 10 aryl, or R 11 -substituted or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 1 is independently halogen. In embodiments, R 1 is independently unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 1 is independently halogen. In embodiments, R 1 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl.

In embodiments, R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 11 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 11 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 11 is substituted, it is substituted with at least one substituent group. In embodiments, when R 11 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 11 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 12 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 12 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 12 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 12 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 12 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 12 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R 11 is unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 12 -substituted or unsubstituted C 1 -C 8 alkyl, R 12 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 12 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 12 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 12 -substituted or unsubstituted C 6 -C 10 aryl, or R 12 -substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, R 11 is unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

R 12 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 12 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 12 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 2 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 2 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 2 is substituted, it is substituted with at least one substituent group. In embodiments, when R 2 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 2 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 21 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 21 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 21 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 21 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 21 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 21 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); two R 2 substituents may optionally be joined to form an R 21 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 21 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 21 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 21 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 21 -substituted or unsubstituted C 1 -C 8 alkyl, R 21 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 21 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 21 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 21 -substituted or unsubstituted C 6 -C 10 aryl, or R 21 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an R 21 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 21 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 21 -substituted or unsubstituted C 6 -C 10 aryl, or R 21 -substituted or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 2 is independently halogen, —CF 3 , —NO 2 , R 21 -substituted or unsubstituted C 1 -C 3 alkyl, unsubstituted 2 to 3 membered heteroalkyl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an unsubstituted phenyl.

In embodiments, R 2 is independently halogen, —CF 3 , —NO 2 , R 11 -substituted or unsubstituted C 1 -C 3 alkyl, unsubstituted 2 to 3 membered heteroalkyl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an unsubstituted phenyl; and R 21 is independently —OH.

In embodiments, R 2 is independently halogen. In embodiments, R 2 is independently —Cl. In embodiments, R 2 is independently —Br. In embodiments, R 2 is independently —I. In embodiments, R 2 is independently —F. In embodiments, R 2 is independently —CF 3 . In embodiments, R 2 is independently —NO 2 . In embodiments, R 2 is independently R 21 -substituted C 1 -C 4 alkyl. In embodiments, R 2 is independently R 21 -substituted C 1 -C 4 alkyl, wherein R 21 is independently —OH. In embodiments, R 2 is independently —CH 2 OH. In embodiments, R 2 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 2 is independently unsubstituted methyl. In embodiments, R 2 is independently unsubstituted ethyl. In embodiments, R 2 is independently unsubstituted n-propyl. In embodiments, R 2 is independently unsubstituted isopropyl. In embodiments, R 2 is independently unsubstituted n-butyl. In embodiments, R 2 is independently unsubstituted tert-butyl. In embodiments, R 2 is independently unsubstituted 2 to 4 membered heteroalkyl. In embodiments, R 2 is independently —OCH 3 . In embodiments, R 2 is independently —OCH 2 CH 3 . In embodiments, R 2 is independently a bond to the binder linker. In embodiments, two R 2 substituents may optionally be joined to form an unsubstituted phenyl.

R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl.

In embodiments, R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 21 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 21 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 21 is substituted, it is substituted with at least one substituent group. In embodiments, when R 21 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 21 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 22 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 22 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 22 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 22 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 22 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 22 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, R 21 is unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 22 -substituted or unsubstituted C 1 -C 8 alkyl, R 22 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 22 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 22 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 22 -substituted or unsubstituted C 6 -C 10 aryl, or R 22 -substituted or unsubstituted 5 to 10 membered heteroaryl.

R 22 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 22 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 22 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 22 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroarylene.

In embodiments, a substituted L 3 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 3 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L 3 is substituted, it is substituted with at least one substituent group. In embodiments, when L 3 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 3 is substituted, it is substituted with at least one lower substituent group.

In embodiments, L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, R 3 -substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 3 -substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 3 -substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 3 -substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 3 -substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or R 3 -substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, R 3 -substituted or unsubstituted C 1 -C 8 alkylene, R 3 -substituted or unsubstituted 2 to 8 membered heteroalkylene, R 3 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 3 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 3 -substituted or unsubstituted C 6 -C 10 arylene, or R 3 -substituted or unsubstituted 5 to 10 membered heteroarylene.

In embodiments, L 3 is —N(R 3 )—. In embodiments, L 3 is —N(R 3 )—; R 3 is independently R 31 -substituted methyl, unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl; and R 31 is independently unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl. In embodiments, L 3 is

In embodiments, L 3 is

In embodiments, L 3 is —CH 2 NH—.

In embodiments, R 3 is independently R 31 -substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 3 is independently R 31 -substituted C 1 -C 4 alkyl. In embodiments, R 3 is independently R 31 -substituted methyl. In embodiments, R 3 is independently R 31 -substituted ethyl. In embodiments, R 3 is independently R 31 -substituted propyl. In embodiments, R 3 is independently R 31 -substituted butyl. In embodiments, R 3 is independently halogen. In embodiments, R 3 is independently —F. In embodiments, R 3 is independently —Cl. In embodiments, R 3 is independently —Br. In embodiments, R 3 is independently —I. In embodiments, R 3 is independently R 31 -substituted or unsubstituted phenyl. In embodiments, R 3 is independently R 31 -substituted phenyl. In embodiments, R 3 is independently

In embodiments, R 31 is independently —C(O)H, —COOH, or R 32 -substituted or unsubstituted 2 to 6 membered heteroalkyl. In embodiments, R 31 is independently —C(O)H. In embodiments, R 31 is independently —COOH. In embodiments, R 31 is independently R 32 -substituted 2 to 6 membered heteroalkyl. In embodiments, R 31 is independently unsubstituted 2 to 6 membered heteroalkyl. In embodiments, R 31 is independently

In embodiments, R 31 is independently R 32 -substituted or unsubstituted phenyl. In embodiments, R 31 is independently unsubstituted phenyl. In embodiments, R 32 is independently oxo.

In embodiments, R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

In embodiments, R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 3 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 3 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 3 is substituted, it is substituted with at least one substituent group. In embodiments, when R 3 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 3 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 31 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 31 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 31 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 31 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 31 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 31 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 31 -substituted or unsubstituted C 1 -C 8 alkyl, R 31 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 31 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 31 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 31 -substituted or unsubstituted C 6 -C 10 aryl, or R 31 -substituted or unsubstituted 5 to 10 membered heteroaryl.

R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl.

In embodiments, R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 31 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 31 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 31 is substituted, it is substituted with at least one substituent group. In embodiments, when R 31 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 31 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 32 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 32 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 32 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 32 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 32 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 32 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 32 -substituted or unsubstituted C 1 -C 8 alkyl, R 32 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 32 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 32 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 32 -substituted or unsubstituted C 6 -C 10 aryl, or R 32 -substituted or unsubstituted 5 to 10 membered heteroaryl.

R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 4 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 4 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 4 is substituted, it is substituted with at least one substituent group. In embodiments, when R 4 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 4 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 4 is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 4 is independently hydrogen. In embodiments, R 4 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 4 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 4 is independently unsubstituted methyl. In embodiments, R 4 is independently unsubstituted ethyl. In embodiments, R 4 is independently unsubstituted n-propyl. In embodiments, R 4 is independently unsubstituted isopropyl. In embodiments, R 4 is independently unsubstituted n-butyl. In embodiments, R 4 is independently unsubstituted tert-butyl. In embodiments, R 4 is independently E, wherein E is as described herein, including in embodiments.

In embodiments, R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 41 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 41 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 41 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 41 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 41 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 41 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or E.

In embodiments, R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 41 -substituted or unsubstituted C 1 -C 8 alkyl, R 41 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 41 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 41 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 41 -substituted or unsubstituted C 6 -C 10 aryl, or R 41 -substituted or unsubstituted 5 to 10 membered heteroaryl, or E.

R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl.

In embodiments, R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 41 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 41 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 41 is substituted, it is substituted with at least one substituent group. In embodiments, when R 41 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 41 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 42 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 42 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 42 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 42 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 42 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 42 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 42 -substituted or unsubstituted C 1 -C 8 alkyl, R 42 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 42 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 42 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 42 -substituted or unsubstituted C 6 -C 10 aryl, or R 42 -substituted or unsubstituted 5 to 10 membered heteroaryl.

R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, E is a covalent cysteine modifier moiety.

In embodiments, E is

R 15 , R 16 , R 17 , and R 18 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X 17 is halogen. In embodiments, X 17 is —F. In embodiments, X 17 is —Cl.

In embodiments, E is

R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. X 17 is halogen. In embodiments, X 17 is —F. In embodiments, X 17 is —Cl.

In embodiments, R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C4-C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 18 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 15 , R 16 , R 17 , and R 18 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted aryl, or substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl.

In embodiments, a substituted R 15 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 15 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 15 is substituted, it is substituted with at least one substituent group. In embodiments, when R 15 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 15 is substituted, it is substituted with at least one lower substituent group.

In embodiments, a substituted R 16 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 16 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 16 is substituted, it is substituted with at least one substituent group. In embodiments, when R 16 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 16 is substituted, it is substituted with at least one lower substituent group.

In embodiments, a substituted R 17 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 17 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 17 is substituted, it is substituted with at least one substituent group. In embodiments, when R 17 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 17 is substituted, it is substituted with at least one lower substituent group.

In embodiments, a substituted R 18 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 18 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 18 is substituted, it is substituted with at least one substituent group. In embodiments, when R 18 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 18 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 15 , R 16 , R 17 , and R 18 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C3-C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, E is

and R 15 , R 16 , R 17 , and R 18 are independently hydrogen.

In embodiments, E is

and R 15 , R 16 , and R 17 are independently hydrogen. In embodiments, E is

and R 17 is independently —Cl.

In embodiments, -L 3 -R 4 is:

In embodiments, -L 3 -R 4 is:

In embodiments, -L 3 -R 4 is:

In embodiments, -L 3 -R 4 is:

In embodiments, z1 is an integer from 0 to 2. In embodiments, z2 is an integer from 0 to 2. In embodiments, z1 is 0. In embodiments, z1 is 1. In embodiments, z1 is 2. In embodiments, z1 is 3. In embodiments, z1 is 4. In embodiments, z2 is 0. In embodiments, z2 is 1. In embodiments, z2 is 2. In embodiments, z2 is 3. In embodiments, z2 is 4. In embodiments, z2 is 5.

In embodiments, z2 is 1 and R 2 is a bond to the binder linker.

In embodiments, R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 7 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 7 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 7 is substituted, it is substituted with at least one substituent group. In embodiments, when R 7 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 7 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 1 , R 2 , and R 7 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents or two R 7 substituents may optionally be joined to form an R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 51 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 51 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 51 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 51 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 51 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker; two R 7 substituents may optionally be joined to form an R 51 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 51 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 51 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 51 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 7 substituents may optionally be joined to form an R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 5 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 5 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 5 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 5 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 5 is substituted, it is substituted with at least one substituent group. In embodiments, when R 5 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 5 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 5 is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 5 is independently hydrogen. In embodiments, R 5 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 5 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 5 is independently unsubstituted methyl. In embodiments, R 5 is independently unsubstituted ethyl. In embodiments, R 5 is independently unsubstituted n-propyl. In embodiments, R 5 is independently unsubstituted isopropyl. In embodiments, R 5 is independently unsubstituted n-butyl. In embodiments, R 5 is independently unsubstituted tert-butyl.

In embodiments, R 6 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 6 is independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkyl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted aryl, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroaryl, or a bond to the binder linker.

In embodiments, a substituted R 6 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R 6 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R 6 is substituted, it is substituted with at least one substituent group. In embodiments, when R 6 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R 6 is substituted, it is substituted with at least one lower substituent group.

In embodiments, R 6 is independently hydrogen or substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 6 is independently hydrogen. In embodiments, R 6 is independently substituted or unsubstituted C 1 -C 4 alkyl. In embodiments, R 6 is independently unsubstituted C 1 -C 4 alkyl. In embodiments, R 6 is independently unsubstituted methyl. In embodiments, R 6 is independently unsubstituted ethyl. In embodiments, R 6 is independently unsubstituted n-propyl. In embodiments, R 6 is independently unsubstituted isopropyl. In embodiments, R 6 is independently unsubstituted n-butyl. In embodiments, R 6 is independently unsubstituted tert-butyl.

In embodiments, R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 51 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 51 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C5-C 6 ), R 51 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 51 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 51 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bond to the binder linker.

In embodiments, R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker.

R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 51 -substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 51 -substituted or unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 51 -substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 51 -substituted or unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or R 51 -substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered); or a bond to the binder linker; wherein only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; and R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl; or a bond to the binder linker; wherein only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; and R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, the binder linker is L 11 -L 12 -L 13 -L 14 . L 11 is connected directly to the E3 Ubiquitin ligase binder.

L 11 is a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, L 11 is a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bioconjugate linker.

In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bioconjugate linker.

In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 61 -substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 61 -substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 61 -substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 61 -substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or R 61 -substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bioconjugate linker. In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bioconjugate linker.

In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted C 1 -C 20 alkylene, R 61 -substituted or unsubstituted 2 to 20 membered heteroalkylene, R 61 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 61 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 61 -substituted or unsubstituted C 6 -C 10 arylene, R 61 -substituted or unsubstituted 5 to 10 membered heteroarylene, or a bioconjugate linker. In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, a substituted L 11 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 11 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L 11 is substituted, it is substituted with at least one substituent group. In embodiments, when L 11 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 11 is substituted, it is substituted with at least one lower substituent group.

In embodiments, L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), R 61 -substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), R 61 -substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), R 61 -substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), R 61 -substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or R 61 -substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), or a bioconjugate linker.

In embodiments, L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted C 1 -C 20 alkylene, R 61 -substituted or unsubstituted 2 to 20 membered heteroalkylene, R 61 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 61 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 61 -substituted or unsubstituted C 6 -C 10 arylene, R 61 -substituted or unsubstituted 5 to 10 membered heteroarylene, or a bioconjugate linker. In embodiments, L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, L 12 is independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, a substituted L 12 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 12 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L 12 is substituted, it is substituted with at least one substituent group. In embodiments, when L 12 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 12 is substituted, it is substituted with at least one lower substituent group.

In embodiments, L 13 is independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, a substituted L 13 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 13 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L 13 is substituted, it is substituted with at least one substituent group. In embodiments, when L 13 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 13 is substituted, it is substituted with at least one lower substituent group.

In embodiments, L 14 is independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

In embodiments, a substituted L 14 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 14 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L 14 is substituted, it is substituted with at least one substituent group. In embodiments, when L 14 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 14 is substituted, it is substituted with at least one lower substituent group.

R 61 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, or unsubstituted heteroaryl.

In embodiments, R 61 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted alkyl (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C 6 -C 10 or phenyl), or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, R 61 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

In embodiments, the binder linker has the formula:

wherein p1 is an integer from 1 to 6. In embodiments, the binder linker has the formula:

wherein p1 is an integer from 1 to 6. In embodiments, p1 is 3. In embodiments, the binder linker has the formula:

In embodiments, the binder linker has the formula:

In embodiments, the binder linker is an unsubstituted C 1 -C 12 alkylene. In embodiments, the binder linker is an unsubstituted C 1 -C 10 alkylene. In embodiments, the binder linker is an unsubstituted C 1 -C 8 alkylene. In embodiments, the binder linker is an unsubstituted C 2 -C 10 alkylene. In embodiments, the binder linker is an unsubstituted C 2 -C 6 alkylene. In embodiments, the binder linker is an unsubstituted C 1 -C 4 alkylene. In embodiments, the binder linker is an unsubstituted C 1 alkylene. In embodiments, the binder linker is an unsubstituted C 2 alkylene. In embodiments, the binder linker is an unsubstituted C 3 alkylene. In embodiments, the binder linker is an unsubstituted C 4 alkylene.

In embodiments, the binder linker has the formula:

wherein p1 is an integer from 1 to 6. In embodiments, p1 is 3. In embodiments, the binder linker has the formula:

In embodiments, the binder linker has the formula:

In embodiments, the binder linker is an unsubstituted C 1 -C 12 alkylene. In embodiments, the binder linker is an unsubstituted C 1 -C 10 alkylene. In embodiments, the binder linker is an unsubstituted C 1 -C 8 alkylene. In embodiments, the binder linker is an unsubstituted C 2 -C 10 alkylene. In embodiments, the binder linker is an unsubstituted C 2 -C 6 alkylene. In embodiments, the binder linker is an unsubstituted C 1 -C 4 alkylene. In embodiments, the binder linker is an unsubstituted C 1 alkylene. In embodiments, the binder linker is an unsubstituted C 2 alkylene. In embodiments, the binder linker is an unsubstituted C 3 alkylene. In embodiments, the binder linker is an unsubstituted C 4 alkylene.

In embodiments, z7 is an integer from 0 to 2. In embodiments, z7 is 0. In embodiments, z7 is 1. In embodiments, z7 is 2. In embodiments, z7 is 3. In embodiments, z7 is 4. In embodiments, z7 is 5. In embodiments, z7 is 6. In embodiments, z7 is 7. In embodiments, z7 is 8. In embodiments, z7 is 9. In embodiments, z7 is 10.

In embodiments, the targeted protein binder is capable of binding a targeted protein associated with a disease. In embodiments, the targeted protein binder is

and the targeted protein binder binds BRD4.

In an aspect is provided a compound having the formula:

wherein R 1 , R 2 , z1, z2, L 3 , and R 4 are as described herein.

In an aspect is provided a compound having the formula:

wherein R 1 , R 2 , R 5 , R 6 , R 7 , L 3 , z1, z2, z7, and R 4 are as described herein.

In an aspect is provided a compound having the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In an aspect is provided a compound having the formula:

wherein R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein.

In an aspect is provided a compound having the formula:

wherein R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein.

In an aspect is provided a compound having the formula:

wherein R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, R 4 is independently E, wherein E is as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, R 4 is independently E, wherein E is as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, R 4 is independently E, wherein E is as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder has the formula:

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader has the formula:

In embodiments, the targeted protein degrader is a compound described herein (e.g., in an aspect, embodiment, example, table, figure, or claim). In embodiments, the compound is a compound described herein (e.g., in an aspect, embodiment, example, table, figure, or claim). In embodiments, the compound is a targeted protein degrader described herein (e.g., in an aspect, embodiment, example, table, figure, or claim). In embodiments, the E3 ubiquitin ligase binder is a monovalent form of a compound described herein (e.g., in an aspect, embodiment, example, table, figure, or claim). In embodiments, the targeted protein binder is a monovalent form of a compound described herein (e.g., in an aspect, embodiment, example, table, figure, or claim).

III. Pharmaceutical Compositions

In an aspect is provided a pharmaceutical composition including a compound as described herein (e.g., a targeted protein degrader as described herein), including embodiments, and a pharmaceutically acceptable excipient. In embodiments, the compound as described herein is included in a therapeutically effective amount.

In embodiments of the pharmaceutical compositions, the compound, or pharmaceutically acceptable salt thereof, is included in a therapeutically effective amount.

In embodiments of the pharmaceutical compositions, the pharmaceutical composition includes a second agent (e.g., therapeutic agent). In embodiments of the pharmaceutical compositions, the pharmaceutical composition includes a second agent (e.g., therapeutic agent) in a therapeutically effective amount. In embodiments of the pharmaceutical compositions, the second agent is an agent for treating cancer. In embodiments, the second agent is an anti-cancer agent. In embodiments, the second agent is a chemotherapeutic. In embodiments, the second agent is an anti-inflammatory agent. In embodiments, the administering does not include administration of any active agent other than the recited active agent (e.g., a compound described herein).

The pharmaceutical compositions may include optical isomers, diastereomers, or pharmaceutically acceptable salts of the modulators disclosed herein. The compound included in the pharmaceutical composition may be covalently attached to a carrier moiety. Alternatively, the compound included in the pharmaceutical composition is not covalently linked to a carrier moiety.

In an aspect is provided a pharmaceutical composition including a targeted protein degrader (e.g., as described herein or a compound described herein) and a pharmaceutically acceptable excipient.

In embodiments, the pharmaceutical composition includes an effective amount of the targeted protein degrader. In embodiments, the pharmaceutical composition includes a therapeutically effective amount of the targeted protein degrader. In embodiments, the pharmaceutical composition includes a second agent. In embodiments of the pharmaceutical compositions, the pharmaceutical composition includes a second agent in a therapeutically effective amount.

IV. Methods of Use

In an aspect is provided a method of reducing (e.g., reducing relative to a control) the level of a cellular protein, said method including contacting the cellular protein with a targeted protein degrader. In embodiments, the targeted protein degrader is a compound described herein.

In an aspect is provided a method of reducing (e.g., reducing relative to a control) the level of a cellular protein, said method including contacting the cellular protein with a targeted protein degrader (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein). In embodiments, the targeted protein degrader is a compound described herein.

In embodiments, the method further includes the steps of: (A) Allowing the cellular protein contacting the targeted protein degrader to be ubiquitinated and thereby form a ubiquitinated cellular protein; and (B) Allowing the ubiquitinated cellular protein to contact the proteasome and thereby form a ubiquitinated cellular protein-proteasome complex; and proteolyzing the cellular protein by the proteasome.

In an aspect is provided a method of treating cancer, the method including contacting a cellular protein associated with cancer with a targeted protein degrader (e.g., a compound described herein).

In an aspect is provided a method of treating cancer, the method including contacting a cellular protein associated with cancer with a targeted protein degrader (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein).

In an aspect is provided a method of treating cancer, the method including administering to a subject in need thereof a therapeutically effective amount of a targeted protein binder as described herein, including embodiments.

In embodiments, the cancer is breast cancer. In embodiments, the cancer is triple-negative breast cancer. In embodiments, the cancer is renal cell carcinoma. In embodiments, the cancer is follicular lymphoma. In embodiments, the cancer is glioblastoma. In embodiments, the cancer is colorectal cancer. In embodiments, the cancer is endometrial cancer. In embodiments, the cancer is lung cancer. In embodiments, the cancer is pancreatic cancer. In embodiments, the cancer is melanoma. In embodiments, the cancer is acute myeloid leukemia. In embodiments, the cancer is endometrial cancer. In embodiments, the cancer is non-Hodgkin lymphoma. In embodiments, the cancer is mantle cell lymphoma. In embodiments, the method includes immunomodulation. In embodiments, the method includes cancer immunotherapy (e.g., immunostimulant, immunotoxin, or radioimmunotherapy).

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby forming a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader includes: (i) an E3 Ubiquitin ligase binder; (ii) a targeted protein binder; and (iii) a binder linker directly bonded to the E3 Ubiquitin ligase binder and the targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby form a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader includes: (i) a monovalent E3 Ubiquitin ligase binder; (ii) a monovalent targeted protein binder; and (iii) a binder linker directly bonded to the monovalent E3 Ubiquitin ligase binder and the monovalent targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby forming a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader includes: (i) an E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein); (ii) a targeted protein binder; and (iii) a binder linker directly bonded to the E3 Ubiquitin ligase binder and the targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby form a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader includes: (i) a monovalent E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein); (ii) a monovalent targeted protein binder; and (iii) a binder linker directly bonded to the monovalent E3 Ubiquitin ligase binder and the monovalent targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby forming a cellular protein-targeted protein binder complex; wherein the targeted protein degrader includes: (i) an E3 Ubiquitin ligase binder; (ii) a targeted protein binder; and (iii) a binder linker directly bonded to the E3 Ubiquitin ligase binder and the targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby form a cellular protein-targeted protein binder complex; wherein the targeted protein degrader includes: (i) a monovalent E3 Ubiquitin ligase binder; (ii) a monovalent targeted protein binder; and (iii) a binder linker directly bonded to the monovalent E3 Ubiquitin ligase binder and the monovalent targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby form a cellular protein-targeted protein binder complex; wherein the targeted protein degrader includes: (i) an E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein); (ii) a targeted protein binder; and (iii) a binder linker directly bonded to the E3 Ubiquitin ligase binder and the targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In an aspect is provided a method of reducing the level of a cellular protein, the method including contacting the cellular protein with a targeted protein degrader and thereby form a cellular protein-targeted protein binder complex; wherein the targeted protein degrader includes: (i) a monovalent E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein); (ii) a monovalent targeted protein binder; and (iii) a binder linker directly bonded to the monovalent E3 Ubiquitin ligase binder and the monovalent targeted protein binder. In embodiments, the method further includes, prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader. In embodiments, the method further includes prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

In embodiments, the method further includes the E3 Ubiquitin ligase binder is identified by a method including the steps: (i) contacting an E3 Ubiquitin ligase protein with a mixture of candidate E3 Ubiquitin ligase binders and thereby forming an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex; and identifying the candidate E3 Ubiquitin ligase binders from an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex as E3 Ubiquitin ligase binders.

In embodiments, the method further includes the E3 Ubiquitin ligase binder is identified by a method including the steps: (i) contacting an E3 Ubiquitin ligase protein with a mixture of compounds including candidate E3 Ubiquitin ligase binders and thereby forming an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex; and identifying the compounds including candidate E3 Ubiquitin ligase binders from an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex as compounds including E3 Ubiquitin ligase binders.

In embodiments, the method further includes the steps: (i) contacting an E3 Ubiquitin ligase protein with a plurality of E3 Ubiquitin ligase binders and thereby forming an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex; and identifying the E3 Ubiquitin ligase binders from an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex as E3 Ubiquitin ligase binders.

In embodiments, the method further includes the steps: (i) contacting an E3 Ubiquitin ligase protein with a plurality of candidate E3 Ubiquitin ligase binders and thereby forming an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex; and identifying the candidate E3 Ubiquitin ligase binders from an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex as E3 Ubiquitin ligase binders.

In embodiments, the candidate E3 Ubiquitin ligase binders include a covalent cysteine modifier moiety and a candidate E3 Ubiquitin ligase binder is identified as an E3 Ubiquitin ligase binder by detection of covalent binding of the E3 Ubiquitin ligase binder to the E3 Ubiquitin ligase protein to form an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex.

In embodiments, the detection of an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex comprises use of a detectable label or mass spectroscopy. In embodiments, prior to the synthesizing, the targeted protein binder is identified.

In embodiments, the targeted protein binder is identified by a method including the steps: (i) mixing a cellular protein with a library of candidate targeted protein binders and thereby forming a cellular protein-targeted protein binder complex; and (ii) identifying the targeted protein binder that forms a cellular protein-targeted protein binder complex. In embodiments, the candidate targeted protein binder forming a cellular protein-targeted protein binder complex is identified as a targeted protein binder by detection of the cellular protein-targeted protein binder complex. In embodiments, the detection of cellular protein-targeted protein binder complex includes use of a detectable label or mass spectroscopy. In embodiments, prior to the synthesizing, the E3 Ubiquitin ligase binder is modified (e.g., the E3 Ubiquitin ligase binder undergoes a chemical reaction to remove a covalent cysteine modifier moiety) to remove a covalent cysteine modifier moiety.

In embodiments, the targeted protein binder is identified by a method including the steps: (i) mixing a cellular protein with a library of compounds including candidate targeted protein binders and thereby forming a cellular protein-targeted protein binder complex; and (ii) identifying the compounds including the targeted protein binder that forms a cellular protein-targeted protein binder complex. In embodiments, the compound including the candidate targeted protein binder forming a cellular protein-targeted protein binder complex is identified as a compound including a targeted protein binder by detection of the cellular protein-targeted protein binder complex. In embodiments, the detection of cellular protein-targeted protein binder complex includes use of a detectable label or mass spectroscopy. In embodiments, prior to the synthesizing, the E3 Ubiquitin ligase binder is modified (e.g., the E3 Ubiquitin ligase binder undergoes a chemical reaction to remove a covalent cysteine modifier moiety) to remove a covalent cysteine modifier moiety.

In embodiments, the cellular protein is BRD4. In embodiments, the level of BRD4 is reduced by greater than 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or greater than 10,000 fold compared to the absence of a targeted protein degrader. In embodiments, the level of BRD4 is reduced by about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or about 10,000 fold compared to the absence of a targeted protein degrader. In embodiments, the level of BRD4 is reduced by 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, or 10,000 fold compared to the absence of a targeted protein degrader.

In an aspect is provided a method of identifying a cellular protein contacted by a targeted protein binder including: (A) contacting a first sample of a cell proteome or cell with the targeted protein binder thereby forming a cellular protein-targeted protein binder complex; (B) contacting both the resulting first sample of a cell proteome or cell of step A and a second sample of the cell proteome or cell that has not been contacted with the targeted protein binder, with a compound having the formula:

wherein L 100 is a covalent linker (e.g., a bond, —S(O) 2 —, —NH—, —O—, —S—, —C(O)—, —C(O)NH—, —NHC(O)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene) and R 100 is a detectable moiety; (C) contacting the resulting first sample of step B with a first detectable agent and the resulting second sample of step B with a second detectable agent; (D) measuring the level of the first detectable agent and second detectable agent bound to selected proteins; and (E) identifying the cellular protein in a cellular protein-targeted protein binder complex by measuring a difference between the level of the first detectable agent and second detectable agent bound to the cellular protein capable of forming the cellular protein-targeted protein binder complex. In embodiments, the method further includes (A) One of the first or second detectable agents includes a light isotope of an atom and a second of the first or second detectable agents includes a heavy isotope of the atom; (B) the level of the first detectable agent and second detectable agent of selected proteins is measured by liquid chromatography mass spectrometry; and (C) the cellular protein capable of binding the targeted protein binder is identified by a difference between the level of the cellular protein bound to the first detectable agent and the level of the cellular protein bound to the second detectable agent.

In embodiments, the cell is a mammalian cell. In embodiments, the cell is a human cell. In embodiments, the cell is a disease cell. In embodiments, the cell is a cancer cell. In embodiments, the cell is a breast cancer cell. In embodiments, the cell is a triple negative breast cancer cell. In embodiments, the cell is a 231MFP cell. In embodiments, the cell is a HCC38 cell.

In embodiments, the compound is:

In embodiments, the compound is:

In embodiments, the compound is:

In embodiments, the compound is:

In embodiments, L 100 is a bond, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. In embodiments, R 100 is rhodamine moiety. In embodiments, the compound is:

wherein L 100 is as described herein. In embodiments, L 100 is a bond or substituted or unsubstituted C 1 -C 4 alkylene. In embodiments, the compound is:

In embodiments, L 100 is a bond, —S(O) 2 —, —NH—, —O—, —S—, —C(O)—, —C(O)NH—, —NHC(O)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).

In embodiments, L 100 is a bond, —S(O) 2 —, —NH—, —O—, —S—, —C(O)—, —C(O)NH—, —NHC(O)NH—, —C(O)O—, —OC(O)—, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroarylene.

In embodiments, L 100 is substituted or unsubstituted alkylene (e.g., C 1 -C 8 , C 1 -C 6 , C 1 -C 4 , or C 1 -C 2 ), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C 3 -C 8 , C 3 -C 6 , C 4 -C 6 , or C 5 -C 6 ), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C 6 -C 10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, L 100 is substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted (e.g., substituted with a substituent group, a size-limited substituent group, or lower substituent group) or unsubstituted heteroarylene. In embodiments, L 100 is unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, or unsubstituted heteroarylene. In embodiments, L 100 is a bond.

In embodiments, L 100 is a substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted alkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted cycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heterocycloalkylene, substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted arylene, or substituted (e.g., substituted with at least one substituent group, size-limited substituent group, or lower substituent group) or unsubstituted heteroarylene.

In embodiments, a substituted L 100 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L 100 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L 100 is substituted, it is substituted with at least one substituent group. In embodiments, when L 100 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L 100 is substituted, it is substituted with at least one lower substituent group.

In embodiments, the E3 Ubiquitin ligase binder contacts an E3 Ubiquitin ligase cysteine residue (e.g., a cysteine amino acid in human RNF4 or a cysteine amino acid in human RF 114). In embodiments, the E3 Ubiquitin ligase binder contacts an E3 Ubiquitin ligase cysteine residue (e.g., a cysteine amino acid in human RNF4 or a cysteine amino acid in human RF114). In embodiments, the E3 Ubiquitin ligase is human RNF4. In embodiments, the cysteine residue is C132 of human RNF4. In embodiments, the cysteine residue is C135 of human RNF4. In embodiments, the E3 Ubiquitin ligase is human RNF114. In embodiments, the cysteine residue is C8 of human RNF114.

In an aspect is a method of making an E3 Ubiquitin ligase-targeted protein degrader-cellular protein complex including: (A) contacting the E3 Ubiquitin ligase with a targeted protein degrader and thereby forming an E3 Ubiquitin ligase-targeted protein degrader complex; and (B) contacting the E3 Ubiquitin ligase-targeted protein degrader complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-targeted protein degrader-cellular protein complex.

In an aspect is a method of making an E3 Ubiquitin ligase-targeted protein degrader-cellular protein complex including: (A) contacting the E3 Ubiquitin ligase with a targeted protein degrader (e.g., a compound described herein or a targeted protein degrader described herein) and thereby forming an E3 Ubiquitin ligase-targeted protein degrader complex; and (B) contacting the E3 Ubiquitin ligase-targeted protein degrader complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-targeted protein degrader-cellular protein complex.

In an aspect is provided a method of making a cellular protein-targeted protein degrader-E3 Ubiquitin ligase complex including: (A) contacting the cellular protein with a targeted protein degrader and thereby forming a cellular protein-targeted protein degrader complex; and (B) contacting the cellular protein-targeted protein degrader complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-targeted protein degrader-E3 Ubiquitin ligase complex.

In an aspect is provided a method of making a cellular protein-targeted protein degrader-E3 Ubiquitin ligase complex including: (A) contacting the cellular protein with an targeted protein degrader (e.g., a compound described herein or a targeted protein degrader described herein) and thereby forming a cellular protein-targeted protein degrader complex; and (B) contacting the cellular protein-targeted protein degrader complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-targeted protein degrader-E3 Ubiquitin ligase complex.

In an aspect is a method of making an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex including: (A) contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex; and (B) contacting the E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex.

In an aspect is a method of making an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex including: (A) contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein) and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex; and (B) contacting the E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex.

In an aspect is provided a method of making a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex including: (A) contacting the cellular protein with an E3 Ubiquitin ligase binder and thereby forming a cellular protein-E3 Ubiquitin ligase binder complex; and (B) contacting the cellular protein-E3 Ubiquitin ligase binder complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex.

In an aspect is provided a method of making a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex including: (A) contacting the cellular protein with an E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein) and thereby forming a cellular protein-E3 Ubiquitin ligase binder complex; and (B) contacting the cellular protein-E3 Ubiquitin ligase binder complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex.

In an aspect is provided a method of inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex including contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex.

In an aspect is provided a method of inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex including contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder (e.g., a compound described herein or an E3 Ubiquitin ligase binder described herein) and thereby inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex.

In embodiments, the E3 Ubiquitin ligase binder covalently bonds a cysteine of the E3 Ubiquitin ligase. In embodiments, the E3 Ubiquitin ligase binder contacts the E3 Ubiquitin ligase at amino acids of the E3 Ubiquitin ligase that are capable of contacting the cellular protein to form the cellular protein-E3 Ubiquitin ligase complex in the absence of the E3 Ubiquitin ligase binder. In embodiments, the E3 Ubiquitin ligase is human RNF4. In embodiments, the E3 Ubiquitin ligase is RNF4 and the cysteine is C132 of human RNF4. In embodiments, the E3 Ubiquitin ligase is RNF4 and the cysteine is C135 of human RNF4.

In embodiments, the E3 Ubiquitin ligase binder has a monovalent form of the formula:

R 1 , R 2 , L 3 , R 4 , z1, and z2 are as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. z1 is an integer from 0 to 4. z2 is an integer from 0 to 5. Only one R 1 or one R 2 is a bond to the binder linker.

In embodiments, the E3 Ubiquitin ligase binder has having the formula

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. z1 is an integer from 0 to 4. z2 is an integer from 0 to 5. Only one R 1 or one R 2 is a bond to the binder linker.

In embodiments, the E3 Ubiquitin ligase is human RNF114. In embodiments, the E3 Ubiquitin ligase is human RNF114 and the cysteine is C8 of human RNF114. In embodiments, the cellular protein is p21.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , L 3 , R 4 , R 5 , R 6 , R 7 , z1, z2, and z7 are as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , and R 7 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents or two R 4 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. z1 is an integer from 0 to 4. z2 is an integer from 0 to 5. z7 is an integer from 0 to 10. Only one R 1 , R 2 , R 5 , R 6 , or R 7 is independently a bond to the binder linker.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

R 1 , R 2 , and R 7 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents or two R 4 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E. E is an electrophilic moiety. z1 is an integer from 0 to 4. z2 is an integer from 0 to 5. z7 is an integer from 0 to 10. Only one R 1 , R 2 , R 5 , R 6 , or R 7 is independently a bond to the binder linker.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2w , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , R 10 , z1, z3, and z7 are as described herein.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are as described herein, including in embodiments.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; or a bond to the binder linker. Only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker.

is a single bond or a double bond.

In embodiments, the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; or a bond to the binder linker. Only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker.

is a single bond or a double bond.

In embodiments, the E3 Ubiquitin ligase binder has the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; or a bond to the binder linker. Only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker.

is a single bond or a double bond.

In embodiments, the E3 Ubiquitin ligase binder contacts amino acids of the E3 Ubiquitin ligase lacking stable secondary or tertiary conformational structure in the absence of the E3 Ubiquitin ligase binder. In embodiments, the amino acids contacting the E3 Ubiquitin ligase binder adopt a stable secondary or tertiary conformational structure upon contacting the E3 Ubiquitin ligase binder.

It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

V. Embodiments

Embodiment P1. A targeted protein degrader comprising 1) a monovalent targeted protein binder and 2) a monovalent E3 Ubiquitin ligase binder, wherein the E3 Ubiquitin ligase is human RNF4 or human RNF114.

Embodiment P2. The targeted protein degrader of embodiment P1 wherein the E3 Ubiquitin ligase binder is capable of forming a covalent bond with a cysteine of an E3 Ubiquitin ligase.

Embodiment P3. The targeted protein degrader of one of embodiments P1 to P2, wherein the targeted protein binder and E3 Ubiquitin ligase binder are covalently bonded by a binder linker.

Embodiment P4. The targeted protein degrader of one of embodiments P1 to P3, wherein the E3 Ubiquitin ligase is human RNF4.

Embodiment P5. The targeted protein degrader of one of embodiments P1 to P4, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

wherein

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E; E is an electrophilic moiety; z1 is an integer from 0 to 4; z2 is an integer from 0 to 5; and wherein only one R 1 or one R 2 is a bond to the binder linker.

wherein

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 11 -substituted or unsubstituted C 1 -C 8 alkyl, R 11 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 11 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 11 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 11 -substituted or unsubstituted C 6 -C 10 aryl, or R 11 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form an R 11 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 11 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 11 -substituted or unsubstituted C 6 -C 10 aryl, or R 1 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 12 -substituted or unsubstituted C 1 -C 8 alkyl, R 2 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 12 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 12 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 2 -substituted or unsubstituted C 6 -C 10 aryl, or R 12 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 12 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl;

R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 21 -substituted or unsubstituted C 1 -C 8 alkyl, R 21 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 21 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 21 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 21 -substituted or unsubstituted C 6 -C 10 aryl, or R 21 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an R 21 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 21 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 21 -substituted or unsubstituted C 6 -C 10 aryl, or R 21 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 22 -substituted or unsubstituted C 1 -C 8 alkyl, R 22 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 22 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 22 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 22 -substituted or unsubstituted C 6 -C 10 aryl, or R 22 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 22 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl;

L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, R 3 -substituted or unsubstituted C 1 -C 8 alkylene, R 3 -substituted or unsubstituted 2 to 8 membered heteroalkylene, R 3 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 3 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 3 -substituted or unsubstituted C 6 -C 10 arylene, or R 3 -substituted or unsubstituted 5 to 10 membered heteroarylene;

R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 31 -substituted or unsubstituted C 1 -C 8 alkyl, R 31 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 31 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 31 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 31 -substituted or unsubstituted C 6 -C 10 aryl, or R 31 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 32 -substituted or unsubstituted C 1 -C 8 alkyl, R 32 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 32 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 32 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 32 -substituted or unsubstituted C 6 -C 10 aryl, or R 32 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl;

R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 41 -substituted or unsubstituted C 1 -C 8 alkyl, R 41 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 41 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 41 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 41 -substituted or unsubstituted C 6 -C 10 aryl, or R 41 -substituted or unsubstituted 5 to 10 membered heteroaryl, or E;

R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 42 -substituted or unsubstituted C 1 -C 8 alkyl, R 42 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 42 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 42 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 42 -substituted or unsubstituted C 6 -C 10 aryl, or R 42 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment P7. The targeted protein degrader of embodiment P6, wherein R 2 is independently halogen, —CF 3 , —NO 2 , R 21 -substituted or unsubstituted C 1 -C 3 alkyl, unsubstituted 2 to 3 membered heteroalkyl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an unsubstituted phenyl; and

R 21 is independently —OH.

Embodiment P8. The targeted protein degrader of one of embodiments P6 to P7, wherein z2 is 1 and R 2 is a bond to the binder linker.

Embodiment P9. The targeted protein degrader of one of embodiments P6 to P8, wherein R 1 is independently halogen.

Embodiment P10. The targeted protein degrader of one of embodiments P6 to P9, wherein z1 is 0.

Embodiment P11. The targeted protein degrader of one of embodiments P6 to P10, wherein L 3 is —N(R 3 )—;

R 3 is independently R 31 -substituted methyl, unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl; and R 31 is independently unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl.

Embodiment P12. The targeted protein degrader of one of embodiments P6 to P11, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

and X 17 is halogen.

Embodiment P13. The targeted protein degrader of one of embodiments P6 to P12, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen.

Embodiment P14. The targeted protein degrader of one of embodiments P6 to P12, wherein E is

and X 17 is independently —Cl.

Embodiment P15. The targeted protein degrader of one of embodiments P1 to P3, wherein the E3 Ubiquitin ligase is human RNF114.

Embodiment P16. The targeted protein degrader of one of embodiments P1 to P3, and P15, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

wherein

R 1 and R 2 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 7 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E; E is an electrophilic moiety; z1 is an integer from 0 to 4; z2 is an integer from 0 to 5; z7 is an integer from 0 to 10; and wherein only one R 1 , R 2 , R 5 , R 6 , or R 7 is independently a bond to the binder linker.

R 1 , R 2 , and R 7 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents may optionally be joined to form an R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —C 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 5 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 11 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 5 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 7 substituents may optionally be joined to form an R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C6-C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, R 3 -substituted or unsubstituted C 1 -C 8 alkylene, R 3 -substituted or unsubstituted 2 to 8 membered heteroalkylene, R 3 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 3 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 3 -substituted or unsubstituted C 6 -C 10 arylene, or R 3 -substituted or unsubstituted 5 to 10 membered heteroarylene; R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 31 -substituted or unsubstituted C 1 -C 8 alkyl, R 31 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 31 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 31 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 31 -substituted or unsubstituted C 6 -C 10 aryl, or R 31 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 32 -substituted or unsubstituted C1-C 8 alkyl, R 32 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 32 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 32 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 32 -substituted or unsubstituted C 6 -C 10 aryl, or R 32 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl; R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 41 -substituted or unsubstituted C 1 -C 8 alkyl, R 41 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 41 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 41 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 41 -substituted or unsubstituted C 6 -C 10 aryl, or R 41 -substituted or unsubstituted 5 to 10 membered heteroaryl, or E; R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 42 -substituted or unsubstituted C1-C 8 alkyl, R 42 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 42 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 42 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 42 -substituted or unsubstituted C 6 -C 10 aryl, or R 42 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment P18. The targeted protein degrader of embodiment P17, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

Embodiment P19. The targeted protein degrader of one of embodiments P17 to P18, wherein L 3 is —CH 2 NH—.

Embodiment P20. The targeted protein degrader of one of embodiments P17 to P19, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

and X 17 is halogen.

Embodiment P21. The targeted protein degrader of one of embodiments P17 to P20, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen.

Embodiment P22. The targeted protein degrader of one of embodiments P17 to P21, wherein E is

and R 15 , R 16 , and R 7 are independently hydrogen.

Embodiment P23. The targeted protein degrader of one of embodiments P1 to P3, and P15, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; or a bond to the binder linker;

wherein only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; and

is a single bond or a double bond.

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl; or a bond to the binder linker; wherein only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment P25. The targeted protein degrader of embodiment P23, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

Embodiment P26. The targeted protein degrader of embodiment P24, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

Embodiment P27. The targeted protein degrader of embodiment P24, wherein the E3 Ubiquitin ligase binder is a monovalent compound having the formula:

Embodiment P28. The targeted protein degrader of embodiment P24, wherein the E3 Ubiquitin ligase binder has the formula:

Embodiment P29. The targeted protein degrader of embodiment P24, wherein the E3 Ubiquitin ligase binder has the formula:

Embodiment P30. The targeted protein degrader of one of embodiments P3 to P29, wherein the binder linker is L 11 -L 12 -L 13 -L 14 ;

L 11 is connected directly to the E3 Ubiquitin ligase binder; L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker; and L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted C 1 -C 20 alkylene, R 61 -substituted or unsubstituted 2 to 20 membered heteroalkylene, R 61 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 61 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 61 -substituted or unsubstituted C 6 -C 10 arylene, R 61 -substituted or unsubstituted 5 to 10 membered heteroarylene, or a bioconjugate linker; L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted C 1 -C 20 alkylene, R 61 -substituted or unsubstituted 2 to 20 membered heteroalkylene, R 61 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 61 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 61 -substituted or unsubstituted C 6 -C 10 arylene, R 61 -substituted or unsubstituted 5 to 10 membered heteroarylene, or a bioconjugate linker; R 61 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C3-C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment P32. The targeted protein degrader of one of embodiments P1 to P31, wherein the targeted protein binder is capable of binding a targeted protein associated with a disease.

Embodiment P33. The targeted protein degrader of one of embodiments P1 to P32, wherein the targeted protein binder is

and the targeted protein binder binds BRD4.

Embodiment P34. A pharmaceutical composition comprising a targeted protein degrader of one of embodiments P1 to P33 and a pharmaceutically acceptable excipient.

Embodiment P35. A method of reducing the level of a cellular protein, said method comprising contacting the cellular protein with a targeted protein degrader.

Embodiment P36. A method of reducing the level of a cellular protein, said method comprising contacting the cellular protein with a targeted protein degrader of one of embodiments 1 to P33.

Embodiment P37. The method of one of embodiments P35 to P36, further comprising the steps of:

A) Allowing the cellular protein contacting the targeted protein degrader to be ubiquitinated and thereby form a ubiquitinated cellular protein; B) Allowing the ubiquitinated cellular protein to contact the proteasome and thereby form a ubiquitinated cellular protein-proteasome complex; and C) proteolyzing the cellular protein by the proteasome.

Embodiment P38. A method of treating cancer, said method comprising contacting a cellular protein associated with cancer with a targeted protein degrader.

Embodiment P39. A method of treating cancer, said method comprising administering to a subject in need thereof a therapeutically effective amount of a targeted protein degrader of one of embodiments P1 to P33.

Embodiment P40. A method of reducing the level of a cellular protein, said method comprising contacting the cellular protein with a targeted protein degrader and thereby forming a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader comprises:

i) a monovalent E3 Ubiquitin ligase binder; ii) a monovalent targeted protein binder; and iii) a binder linker directly bonded to the monovalent E3 Ubiquitin ligase binder and the monovalent targeted protein binder.

Embodiment P41. The method of embodiment P40, wherein prior to the contacting, the targeted protein degrader is synthesized by covalently reacting a E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader.

Embodiment P42. The method of embodiment P41, wherein prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

Embodiment P43. The method of embodiment P42, wherein the E3 Ubiquitin ligase binder is identified by a method comprising the steps:

i) contacting an E3 Ubiquitin ligase protein with a mixture of candidate E3 Ubiquitin ligase binders and thereby forming an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex; and ii) identifying the candidate E3 Ubiquitin ligase binders from an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex as E3 Ubiquitin ligase binders.

Embodiment P44. The method of embodiment P43, wherein the candidate E3 Ubiquitin ligase binders comprise a covalent cysteine modifier moiety and a candidate E3 Ubiquitin ligase binder is identified as an E3 Ubiquitin ligase binder by detection of covalent binding of the E3 Ubiquitin ligase binder to the E3 Ubiquitin ligase protein to form an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex.

Embodiment P45. The method of embodiment P44, wherein the detection of an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex comprises use of a detectable label or mass spectroscopy.

Embodiment P46. The method of embodiment P40, wherein prior to the synthesizing, the targeted protein binder is identified.

Embodiment P47. The method of embodiment P46, wherein the targeted protein binder is identified by a method comprising the steps:

i) contacting a cellular protein with a mixture of candidate targeted protein binders and thereby forming a cellular protein-targeted protein binder complex; and ii) identifying the targeted protein binder that forms a cellular protein-targeted protein binder complex.

Embodiment P48. The method of embodiment P47, wherein the candidate targeted protein binder forming a cellular protein-targeted protein binder complex is identified as a targeted protein binder by detection of the cellular protein-targeted protein binder complex.

Embodiment P49. The method of embodiment P48, wherein the detection of cellular protein-targeted protein binder complex comprises use of a detectable label or mass spectroscopy.

Embodiment P50. The method of embodiment P40, wherein prior to the synthesizing, the E3 Ubiquitin ligase binder is modified to remove a covalent cysteine modifier moiety.

Embodiment P51. A method of identifying a cellular protein contacted by a targeted protein binder comprising:

A) contacting a first sample of a cell proteome or cell with the targeted protein binder thereby forming a cellular protein-targeted protein binder complex; B) contacting both the resulting first sample of a cell proteome or cell of step A and a second sample of the cell proteome or cell that has not been contacted with the targeted protein binder, with a compound having the formula:

C) contacting the resulting first sample of step B with a first detectable agent and the resulting second sample of step B with a second detectable agent;

D) measuring the level of the first detectable agent and second detectable agent bound to selected proteins; and

E) identifying the cellular protein in a cellular protein-targeted protein binder complex by measuring a difference between the level of the first detectable agent and second detectable agent bound to the cellular protein capable of forming the cellular protein-targeted protein binder complex.

A) One of the first or second detectable agents comprises a light isotope of an atom and a second of the first or second detectable agents comprises a heavy isotope of the atom; B) the level of the first detectable agent and second detectable agent of selected proteins is measured by liquid chromatography mass spectrometry; and C) the cellular protein capable of binding the targeted protein binder is identified by a difference between the level of the cellular protein bound to the first detectable agent and the level of the cellular protein bound to the second detectable agent.

Embodiment P53. The method of one of embodiment P35 to P52, wherein the E3 Ubiquitin ligase binder contacts an E3 Ubiquitin ligase cysteine residue.

Embodiment P54. The method of embodiment P53, wherein the E3 Ubiquitin ligase binder covalently binds an E3 Ubiquitin ligase cysteine residue.

Embodiment P55. The method of one of embodiments P53 to P54 wherein the E3 Ubiquitin ligase is human RNF4.

Embodiment P56. The method of embodiment P55, wherein the cysteine residue is C132 of human RNF4.

Embodiment P57. The method of embodiment P55, wherein the cysteine residue is C135 of human RNF4.

Embodiment P58. The method of one of embodiments P53 to P54 wherein the E3 Ubiquitin ligase is human RNF114.

Embodiment P59. The method of embodiment P58, wherein the cysteine residue is C8 of human RNF114.

Embodiment P60. A method of making an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex comprising:

A) contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex; and B) contacting the E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex.

Embodiment P61. A method of making a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex comprising:

A) contacting the cellular protein with an E3 Ubiquitin ligase binder and thereby forming a cellular protein-E3 Ubiquitin ligase binder complex; and B) contacting the cellular protein-E3 Ubiquitin ligase binder complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex.

Embodiment P62. A method of inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex comprising contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex.

Embodiment P63. The method of one of one of embodiments P60 to P62, wherein the E3 Ubiquitin ligase binder covalently bonds a cysteine of the E3 Ubiquitin ligase.

Embodiment P64. The method of one of embodiments P62 to P63, wherein the E3 Ubiquitin ligase binder contacts the E3 Ubiquitin ligase at amino acids of the E3 Ubiquitin ligase that are capable of contacting the cellular protein to form the cellular protein-E3 Ubiquitin ligase complex in the absence of the E3 Ubiquitin ligase binder.

Embodiment P65. The method of one of embodiments P60 to P64, wherein the E3 Ubiquitin ligase is human RNF4.

Embodiment P66. The method of one of embodiments P63 to P64, wherein the E3 Ubiquitin ligase is RNF4 and the cysteine is C132 of human RNF4.

Embodiment P67. The method of one of embodiments P63 to P64, wherein the E3 Ubiquitin ligase is RNF4 and the cysteine is C135 of human RNF4.

Embodiment P68. The method of one of embodiments P65 to P67, wherein the E3 Ubiquitin ligase binder has having the formula:

wherein

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E; E is an electrophilic moiety; z1 is an integer from 0 to 4; and z2 is an integer from 0 to 5.

Embodiment P69. The method of one of embodiments P60 to P64, wherein the E3 Ubiquitin ligase is human RNF114.

Embodiment P70. The method of one of embodiments P63 to P64, wherein the E3 Ubiquitin ligase is human RNF114 and the cysteine is C8 of human RNF114.

Embodiment P71. The method of one of embodiments P69 to P70, wherein the cellular protein is p21.

Embodiment P72. The method of one of embodiments P69 to P71, wherein the E3 Ubiquitin ligase binder has the formula:

R 1 and R 2 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 1 substituents or two R 2 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 7 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;

R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E;

E is an electrophilic moiety;

z1 is an integer from 0 to 4;

z2 is an integer from 0 to 5; and

z7 is an integer from 0 to 10.

Embodiment P73. The method of one of embodiments P69 to P71, wherein the E3 Ubiquitin ligase binder has the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; and

is a single bond or a double bond.

Embodiment P74. The method of one of embodiments P35 to P73, wherein the E3 Ubiquitin ligase binder contacts amino acids of the E3 Ubiquitin ligase lacking stable secondary or tertiary conformational structure in the absence of the E3 Ubiquitin ligase binder.

Embodiment P75. The method of embodiment P74, wherein the amino acids contacting the E3 Ubiquitin ligase binder adopt a stable secondary or tertiary conformational structure upon contacting the E3 Ubiquitin ligase binder.

VI. Additional Embodiments

Embodiment 1. A targeted protein degrader comprising 1) a targeted protein binder and 2) an E3 Ubiquitin ligase binder, wherein the E3 Ubiquitin ligase is human RNF4 or human RNF114.

Embodiment 2. The targeted protein degrader of embodiment 1, wherein the E3 Ubiquitin ligase binder is capable of forming a covalent bond with a cysteine of an E3 Ubiquitin ligase.

Embodiment 3. The targeted protein degrader of one of embodiments 1 to 2, wherein the targeted protein binder and E3 Ubiquitin ligase binder are covalently bonded by a binder linker.

Embodiment 4. The targeted protein degrader of one of embodiments 1 to 3, wherein the E3 Ubiquitin ligase is human RNF4.

Embodiment 5. The targeted protein degrader of one of embodiments 1 to 4, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 11, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E; E is an electrophilic moiety; z1 is an integer from 0 to 4; z2 is an integer from 0 to 5; and wherein only one R 1 or one R 2 is a bond to the binder linker.

wherein

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 11 -substituted or unsubstituted C 1 -C 8 alkyl, R 11 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 11 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 11 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 11 -substituted or unsubstituted C 6 -C 10 aryl, or R 11 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 1 substituents may optionally be joined to form an R 11 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 11 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 11 -substituted or unsubstituted C 6 -C 10 aryl, or R 11 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 11 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 12 -substituted or unsubstituted C 1 -C 8 alkyl, R 12 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 12 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 12 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 12 -substituted or unsubstituted C 6 -C 10 aryl, or R 12 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 12 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl;

R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 21 -substituted or unsubstituted C 1 -C 8 alkyl, R 21 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 21 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 21 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 21 -substituted or unsubstituted C 6 -C 10 aryl, or R 21 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an R 21 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 21 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 21 -substituted or unsubstituted C 6 -C 10 aryl, or R 21 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 21 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 22 -substituted or unsubstituted C 1 -C 8 alkyl, R 22 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 22 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 22 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 22 -substituted or unsubstituted C 6 -C 10 aryl, or R 22 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 22 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl;

L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, R 3 -substituted or unsubstituted C 1 -C 8 alkylene, R 3 -substituted or unsubstituted 2 to 8 membered heteroalkylene, R 3 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 3 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 3 -substituted or unsubstituted C 6 -C 10 arylene, or R 3 -substituted or unsubstituted 5 to 10 membered heteroarylene;

R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 31 -substituted or unsubstituted C 1 -C 8 alkyl, R 31 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 31 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 31 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 31 -substituted or unsubstituted C 6 -C 10 aryl, or R 31 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 32 -substituted or unsubstituted C 1 -C 8 alkyl, R 32 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 32 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 32 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 12 -substituted or unsubstituted C 6 -C 10 aryl, or R 32 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl;

R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 41 -substituted or unsubstituted C 1 -C 8 alkyl, R 41 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 41 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 41 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 41 -substituted or unsubstituted C 6 -C 10 aryl, or R 41 -substituted or unsubstituted 5 to 10 membered heteroaryl, or E;

R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 42 -substituted or unsubstituted C 1 -C 8 alkyl, R 42 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 42 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 42 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 42 -substituted or unsubstituted C 6 -C 10 aryl, or R 42 -substituted or unsubstituted 5 to 10 membered heteroaryl;

R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment 7. The targeted protein degrader of embodiment 6, wherein R 2 is independently halogen, —CF 3 , —NO 2 , R 21 -substituted or unsubstituted C 1 -C 3 alkyl, unsubstituted 2 to 3 membered heteroalkyl, or a bond to the binder linker; two R 2 substituents may optionally be joined to form an unsubstituted phenyl; and

R 21 is independently —OH.

Embodiment 8. The targeted protein degrader of one of embodiments 6 to 7, wherein z2 is 1 and R 2 is a bond to the binder linker.

Embodiment 9. The targeted protein degrader of one of embodiments 6 to 8, wherein R 1 is independently halogen.

Embodiment 10. The targeted protein degrader of one of embodiments 6 to 9, wherein z1 is 0.

Embodiment 11. The targeted protein degrader of one of embodiments 6 to 10, wherein L 3 is —N(R 3 )—;

R 3 is independently R 31 -substituted methyl, unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl; and R 31 is independently unsubstituted phenyl, or unsubstituted 5 to 6 membered heteroaryl.

Embodiment 12. The targeted protein degrader of one of embodiments 6 to 11, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

and X 17 is halogen.

Embodiment 13. The targeted protein degrader of one of embodiments 6 to 12, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen.

Embodiment 14. The targeted protein degrader of one of embodiments 6 to 12, wherein E is

and X 7 is independently —Cl.

Embodiment 15. The targeted protein degrader of one of embodiments 1 to 3, wherein the E3 Ubiquitin ligase is human RNF114.

Embodiment 16. The targeted protein degrader of one of embodiments 1 to 3, and 15, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein

R 1 and R 2 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker;

R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or a bond to the binder linker; two R 7 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;

R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E;

E is an electrophilic moiety;

z1 is an integer from 0 to 4;

z2 is an integer from 0 to 5;

z7 is an integer from 0 to 10; and

wherein only one R 1 , R 2 , R 5 , R 6 , or R 7 is independently a bond to the binder linker.

R 1 , R 2 , and R 7 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 1 substituents or two R 2 substituents may optionally be joined to form an R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl, or a bond to the binder linker; two R 7 substituents may optionally be joined to form an R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl. L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, R 3 -substituted or unsubstituted C 1 -C 8 alkylene, R 3 -substituted or unsubstituted 2 to 8 membered heteroalkylene, R 3 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 3 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 3 -substituted or unsubstituted C 6 -C 10 arylene, or R 3 -substituted or unsubstituted 5 to 10 membered heteroarylene; R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 31 -substituted or unsubstituted C 1 -C 8 alkyl, R 31 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 31 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 31 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 31 -substituted or unsubstituted C 6 -C 10 aryl, or R 31 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 31 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 32 -substituted or unsubstituted C 1 -C 8 alkyl, R 32 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 32 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 32 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 32 -substituted or unsubstituted C 6 -C 10 aryl, or R 32 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 32 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl; R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 41 -substituted or unsubstituted C 1 -C 8 alkyl, R 41 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 41 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 41 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 41 -substituted or unsubstituted C 6 -C 10 aryl, or R 41 -substituted or unsubstituted 5 to 10 membered heteroaryl, or E; R 41 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 42 -substituted or unsubstituted C 1 -C 8 alkyl, R 42 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 42 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 42 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 42 -substituted or unsubstituted C 6 -C 10 aryl, or R 42 -substituted or unsubstituted 5 to 10 membered heteroaryl; R 42 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment 18. The targeted protein degrader of embodiment 17, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

Embodiment 19. The targeted protein degrader of one of embodiments 17 to 18, wherein L 3 is —CH 2 NH—.

Embodiment 20. The targeted protein degrader of one of embodiments 17 to 19, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

and X 7 is halogen.

Embodiment 21. The targeted protein degrader of one of embodiments 17 to 20, wherein E is

R 15 , R 16 , and R 17 are independently hydrogen.

Embodiment 22. The targeted protein degrader of one of embodiments 17 to 21, wherein E is

and R 15 , R 16 , and R 17 are independently hydrogen.

Embodiment 23. The targeted protein degrader of one of embodiments 1 to 3, and 15, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; or a bond to the binder linker;

wherein only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; and

is a single bond or a double bond.

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , R 51 -substituted or unsubstituted C 1 -C 8 alkyl, R 51 -substituted or unsubstituted 2 to 8 membered heteroalkyl, R 51 -substituted or unsubstituted C 3 -C 8 cycloalkyl, R 51 -substituted or unsubstituted 3 to 8 membered heterocycloalkyl, R 51 -substituted or unsubstituted C 6 -C 10 aryl, or R 51 -substituted or unsubstituted 5 to 10 membered heteroaryl; or a bond to the binder linker; wherein only one R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , or R 10 is a bond to the binder linker; R 51 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment 25. The targeted protein degrader of embodiment 23, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

Embodiment 26. The targeted protein degrader of embodiment 24, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

Embodiment 27. The targeted protein degrader of embodiment 24, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

Embodiment 28. The targeted protein degrader of embodiment 24, wherein the E3 Ubiquitin ligase binder has the formula:

Embodiment 29. The targeted protein degrader of embodiment 24, wherein the E3 Ubiquitin ligase binder has the formula:

Embodiment 30. The targeted protein degrader of one of embodiments 3 to 29, wherein the binder linker is L 11 -L 12 -L 13 -L 14 ;

L 11 is connected directly to the E3 Ubiquitin ligase binder; L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker; and L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene, or a bioconjugate linker.

L 11 is —N(R 61 )—, —C(O)—, —C(O)N(R 61 )—, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted C 1 -C 20 alkylene, R 61 -substituted or unsubstituted 2 to 20 membered heteroalkylene, R 61 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 61 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 61 -substituted or unsubstituted C 6 -C 10 arylene, R 61 -substituted or unsubstituted 5 to 10 membered heteroarylene, or a bioconjugate linker; L 12 , L 13 , and L 14 are independently a bond, —N(R 61 )—, —C(O)—, —C(O)N(R 61 )_, —N(R 61 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, —OC(O)—, —S(O) 2 —, —S(O)—, —O—, —S—, —NHC(O)NH—, R 61 -substituted or unsubstituted C 1 -C 20 alkylene, R 61 -substituted or unsubstituted 2 to 20 membered heteroalkylene, R 61 -substituted or unsubstituted C 3 -C 8 cycloalkylene, R 61 -substituted or unsubstituted 3 to 8 membered heterocycloalkylene, R 61 -substituted or unsubstituted C 6 -C 10 arylene, R 61 -substituted or unsubstituted 5 to 10 membered heteroarylene, or a bioconjugate linker; R 61 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , unsubstituted C 1 -C 8 alkyl, unsubstituted 2 to 8 membered heteroalkyl, unsubstituted C 3 -C 8 cycloalkyl, unsubstituted 3 to 8 membered heterocycloalkyl, unsubstituted C 6 -C 10 aryl, or unsubstituted 5 to 10 membered heteroaryl.

Embodiment 32. The targeted protein degrader of one of embodiments 1 to 31, wherein the targeted protein binder is capable of binding a targeted protein associated with a disease.

Embodiment 33. The targeted protein degrader of one of embodiments 1 to 32, wherein the targeted protein binder is

and the targeted protein binder binds BRD4.

Embodiment 34. A pharmaceutical composition comprising a targeted protein degrader of one of embodiments 1 to 33 and a pharmaceutically acceptable excipient.

Embodiment 35. A method of reducing the level of a cellular protein, said method comprising contacting the cellular protein with a targeted protein degrader.

Embodiment 36. A method of reducing the level of a cellular protein, said method comprising contacting the cellular protein with a targeted protein degrader of one of embodiments 1 to 33.

Embodiment 37. The method of one of embodiments 35 to 36, further comprising the steps of:

A) allowing the cellular protein contacting the targeted protein degrader to be ubiquitinated and thereby form a ubiquitinated cellular protein; B) allowing the ubiquitinated cellular protein to contact the proteasome and thereby form a ubiquitinated cellular protein-proteasome complex; and C) proteolyzing the cellular protein by the proteasome.

Embodiment 38. A method of treating cancer, said method comprising contacting a cellular protein associated with cancer with a targeted protein degrader.

Embodiment 39. A method of treating cancer, said method comprising administering to a subject in need thereof a therapeutically effective amount of a targeted protein degrader of one of embodiments 1 to 33.

Embodiment 40. A method of reducing the level of a cellular protein, said method comprising contacting the cellular protein with a targeted protein degrader and thereby forming a targeted protein degrader-cellular protein complex; wherein the targeted protein degrader comprises:

i) an E3 Ubiquitin ligase binder; ii) a targeted protein binder; and iii) a binder linker directly bonded to the E3 Ubiquitin ligase binder and the targeted protein binder.

Embodiment 41. The method of embodiment 40, wherein prior to the contacting, the targeted protein degrader is synthesized by covalently reacting an E3 Ubiquitin ligase binder, a binder linker, and a targeted protein binder to produce the targeted protein degrader.

Embodiment 42. The method of embodiment 41, wherein prior to the synthesizing, the E3 Ubiquitin ligase binder is identified from a candidate E3 Ubiquitin ligase binder.

Embodiment 43. The method of embodiment 42, wherein the E3 Ubiquitin ligase binder is identified by a method comprising the steps:

i) contacting an E3 Ubiquitin ligase protein with a mixture of candidate E3 Ubiquitin ligase binders and thereby forming an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex; and ii) identifying the candidate E3 Ubiquitin ligase binders from an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex as E3 Ubiquitin ligase binders.

Embodiment 44. The method of embodiment 43, wherein the candidate E3 Ubiquitin ligase binders comprise a covalent cysteine modifier moiety and a candidate E3 Ubiquitin ligase binder is identified as an E3 Ubiquitin ligase binder by detection of covalent binding of the E3 Ubiquitin ligase binder to the E3 Ubiquitin ligase protein to form an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex.

Embodiment 45. The method of embodiment 44, wherein the detection of an E3 Ubiquitin ligase protein-E3 Ubiquitin ligase binder complex comprises use of a detectable label or mass spectroscopy.

Embodiment 46. The method of embodiment 40, wherein prior to the synthesizing, the targeted protein binder is identified.

Embodiment 47. The method of embodiment 46, wherein the targeted protein binder is identified by a method comprising the steps:

i) contacting a cellular protein with a mixture of candidate targeted protein binders and thereby forming a cellular protein-targeted protein binder complex; and ii) identifying the targeted protein binder that forms a cellular protein-targeted protein binder complex.

Embodiment 48. The method of embodiment 47, wherein the candidate targeted protein binder forming a cellular protein-targeted protein binder complex is identified as a targeted protein binder by detection of the cellular protein-targeted protein binder complex.

Embodiment 49. The method of embodiment 48, wherein the detection of cellular protein-targeted protein binder complex comprises use of a detectable label or mass spectroscopy.

Embodiment 50. The method of embodiment 40, wherein prior to the synthesizing, the E3 Ubiquitin ligase binder is modified to remove a covalent cysteine modifier moiety.

Embodiment 51. A method of identifying a cellular protein contacted by a targeted protein binder comprising:

A) contacting a first sample of a cell proteome or cell with the targeted protein binder thereby forming a cellular protein-targeted protein binder complex; B) contacting both the resulting first sample of a cell proteome or cell of step A and a second sample of the cell proteome or cell that has not been contacted with the targeted protein binder, with a compound having the formula:

C) contacting the resulting first sample of step B with a first detectable agent and the resulting second sample of step B with a second detectable agent;

D) measuring the level of the first detectable agent and second detectable agent bound to selected proteins; and

E) identifying the cellular protein in a cellular protein-targeted protein binder complex by measuring a difference between the level of the first detectable agent and second detectable agent bound to the cellular protein capable of forming the cellular protein-targeted protein binder complex.

A) one of the first or second detectable agents comprises a light isotope of an atom and a second of the first or second detectable agents comprises a heavy isotope of the atom; B) the level of the first detectable agent and second detectable agent of selected proteins is measured by liquid chromatography mass spectrometry; and C) the cellular protein capable of binding the targeted protein binder is identified by a difference between the level of the cellular protein bound to the first detectable agent and the level of the cellular protein bound to the second detectable agent.

Embodiment 53. The method of one of embodiments 35 to 52, wherein the E3 Ubiquitin ligase binder contacts an E3 Ubiquitin ligase cysteine residue.

Embodiment 54. The method of embodiment 53, wherein the E3 Ubiquitin ligase binder covalently binds an E3 Ubiquitin ligase cysteine residue.

Embodiment 55. The method of one of embodiments 53 to 54, wherein the E3 Ubiquitin ligase is human RNF4.

Embodiment 56. The method of embodiment 55, wherein the cysteine residue is CI 32 of human RNF4.

Embodiment 57. The method of embodiment 55, wherein the cysteine residue is CI 35 of human RNF4.

Embodiment 58. The method of one of embodiments 53 to 54, wherein the E3 Ubiquitin ligase is human RNF114.

Embodiment 59. The method of embodiment 58, wherein the cysteine residue is C8 of human RNF114.

Embodiment 60. A method of making an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex comprising:

A) contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex; and B) contacting the E3 Ubiquitin ligase-E3 Ubiquitin ligase binder complex with the cellular protein and thereby forming an E3 Ubiquitin ligase-E3 Ubiquitin ligase binder-cellular protein complex.

Embodiment 61. A method of making a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex comprising:

A) contacting the cellular protein with an E3 Ubiquitin ligase binder and thereby forming a cellular protein-E3 Ubiquitin ligase binder complex; and B) contacting the cellular protein-E3 Ubiquitin ligase binder complex with the E3 Ubiquitin ligase and thereby forming a cellular protein-E3 Ubiquitin ligase binder-E3 Ubiquitin ligase complex.

Embodiment 62. A method of inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex comprising contacting the E3 Ubiquitin ligase with an E3 Ubiquitin ligase binder and thereby inhibiting the formation of a cellular protein-E3 Ubiquitin ligase complex.

Embodiment 63. The method of one of embodiments 60 to 62, wherein the E3 Ubiquitin ligase binder covalently bonds a cysteine of the E3 Ubiquitin ligase.

Embodiment 64. The method of one of embodiments 62 to 63, wherein the E3 Ubiquitin ligase binder contacts the E3 Ubiquitin ligase at amino acids of the E3 Ubiquitin ligase that are capable of contacting the cellular protein to form the cellular protein-E3 Ubiquitin ligase complex in the absence of the E3 Ubiquitin ligase binder.

Embodiment 65. The method of one of embodiments 60 to 64, wherein the E3 Ubiquitin ligase is human RNF4.

Embodiment 66. The method of one of embodiments 63 to 64, wherein the E3 Ubiquitin ligase is RNF4 and the cysteine is CI 32 of human RNF4.

Embodiment 67. The method of one of embodiments 63 to 64, wherein the E3 Ubiquitin ligase is RNF4 and the cysteine is CI 35 of human RNF4.

Embodiment 68. The method of one of embodiments 65 to 67, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

wherein

R 1 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 1 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 2 is independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 2 substituents may optionally be joined to form a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;

R 3 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E;

E is an electrophilic moiety;

z1 is an integer from 0 to 4; and

z2 is an integer from 0 to 5.

Embodiment 69. The method of one of embodiments 60 to 64, wherein the E3 Ubiquitin ligase is human RNF114.

Embodiment 70. The method of one of embodiments 63 to 64, wherein the E3 Ubiquitin ligase is human RNF114 and the cysteine is C8 of human RNF114.

Embodiment 71. The method of one of embodiments 69 to 70, wherein the cellular protein is p21.

Embodiment 72. The method of one of embodiments 69 to 71, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 and R 2 are independently halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 1 substituents or two R 2 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 5 and R 6 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —C 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 7 is independently oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; two R 7 substituents may optionally be joined to form an substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

L 3 is a bond, —N(R 3 )—, —C(O)—, —C(O)N(R 3 )—, —N(R 3 )C(O)—, —N(H)—, —C(O)N(H)—, —N(H)C(O)—, —C(O)O—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;

R 3 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R 4 is independently hydrogen, oxo, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl, or E;

E is an electrophilic moiety;

z1 is an integer from 0 to 4;

z2 is an integer from 0 to 5; and

z7 is an integer from 0 to 10.

Embodiment 73. The method of one of embodiments 69 to 71, wherein the E3 Ubiquitin ligase binder is a monovalent form of the formula:

R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , R 7 , R 8 , R 9 , and R 10 are independently hydrogen, halogen, —CCl 3 , —CBr 3 , —CF 3 , —CI 3 , —CHCl 2 , —CHBr 2 , —CHF 2 , —CHI 2 , —CH 2 Cl, —CH 2 Br, —CH 2 F, —CH 2 I, —CN, —OH, —NH 2 , —COOH, —CONH 2 , —NO 2 , —SH, —SO 3 H, —SO 4 H, —SO 2 NH 2 , —NHNH 2 , —ONH 2 , —NHC(O)NHNH 2 , —NHC(O)NH 2 , —NHSO 2 H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl 3 , —OCF 3 , —OCBr 3 , —OCI 3 , —OCHCl 2 , —OCHBr 2 , —OCHI 2 , —OCHF 2 , —OCH 2 Cl, —OCH 2 Br, —OCH 2 I, —OCH 2 F, —N 3 , —SF 5 , substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; and

is a single bond or a double bond.

Embodiment 74. The method of one of embodiments 35 to 73, wherein the E3 Ubiquitin ligase binder contacts amino acids of the E3 Ubiquitin ligase lacking stable secondary or tertiary conformational structure in the absence of the E3 Ubiquitin ligase binder.

Embodiment 75. The method of embodiment 74, wherein the amino acids contacting the E3 Ubiquitin ligase binder adopt a stable secondary or tertiary conformational structure upon contacting the E3 Ubiquitin ligase binder.

Example 1: Covalent Ligand Screening Uncovers a RNF4 E3 Ligase Recruiter for Targeted Protein Degradation Application

Targeted protein degradation has arisen as a powerful strategy for drug discovery allowing the targeting of undruggable proteins for proteasomal degradation. This approach employs bifunctional degraders consisting of a protein targeting ligand linked to an E3 ligase recruiter which brings the E3 ligase to particular protein substrates to ubiquitinate and degrade these substrates in a proteasome-dependent manner. One challenge with this approach, however, is the relatively few E3 ligase recruiters that currently exist for targeted protein degradation applications, despite the hundreds of known E3 ligases in the human genome. Here, we have used activity-based protein profiling (ABPP)-based covalent ligand screening approaches to identify cysteine-reactive small-molecules that react with the E3 ubiquitin ligase RNF4. The lead covalent ligand from this screen reacts with one of two zinc-coordinating cysteines in the RING domain, CI 32 and CI 35 , with no effect on RNF4 activity. We further optimized the potency of this lead and incorporated this potential RNF4 recruiter into a bifunctional degrader linked to the BRD4 inhibitor JQ1: CCW 28-3. We demonstrate that CCW 28-3 is capable of degrading BRD4 in a proteasome-dependent manner and that this degradation is attenuated in RNF4 knockout cells. We demonstrate the feasibility of using chemoproteomics-enabled covalent ligand screening platforms to expand the scope of E3 ligase recruiters that can be exploited for targeted protein degradation applications.

Targeted protein degradation is a groundbreaking drug discovery platform for tackling the undruggable proteome by exploiting cellular protein degradation machinery to selectively eliminate target proteins 1,2 . This technology involves the utilization of bifunctional molecules called “degraders” consisting of a protein-targeting ligand linked to an E3 ligase recruiter. These degraders are capable of recruiting E3 ligases to specific protein targets to ubiquitinate and degrade targets in a proteasome-dependent manner. As functional inhibition of the target is not necessary for degrader efficacy this strategy has the potential to target and degrade any protein in the proteome for which there exists a ligand. However, a major challenge in the application of this technology is relatively small number of E3 ligase recruiters. While there are ˜600 different E3 ligases, there are only a few E3 ligase recruiters, including small-molecule recruiters for cereblon, VHL, MDM2, and cIAP 2,3 . Identifying facile strategies for discovering ligands that bind to E3 ligases remains crucial for expanding the set of E3 ligase recruiters that can be utilized for targeted protein degradation applications.

Activity-based protein profiling (ABPP) has arisen as a powerful platform for ligand discovery against undruggable proteins 4-10 . ABPP utilizes reactivity-based chemical probes to map proteome-wide reactive and ligandable hotspots directly in complex biological systems 11,12 . When used in a competitive manner, covalently-acting small-molecules can be competed against the binding of reactivity-based probes to facilitate covalent ligand discovery against proteins of interest 4-7,9,13-15 . Towards discovering covalent ligands that may react with E3 ubiquitin ligases, we first investigated whether representative commercially available E3 ligases could be labeled by the cysteine-reactive iodoacetamide-rhodamine (IA-rhodamine) reactivity-based probe. IA-rhodamine was capable of labeling MDM2, RNF4, and UBE3A in a dose-responsive manner ( FIG. 1 A ). While previous studies have already uncovered MDM2 and UBE3A small-molecule modulators 16-18 , no chemical tools exist for the E3 ubiquitin ligase RNF4, which recognizes SUMOylated proteins and ubiquitinates these proteins for subsequent proteasomal degradation 19,20 . We thus focused our efforts on developing a potential E3 ligase recruiter for RNF4.

In search of RNF4 covalent ligands, we screened our cysteine-reactive covalent ligand library against IA-rhodamine labeling of pure human RNF4 using gel-based ABPP ( FIG. 1 B ; Table 1). We identified several potential hits from this screen, including TRH 1-74, YP 1-44, DKM 2-76, TRH 1-23, and TRH 1-163. From these, YP 1-44, TRH 1-163, and TRH 1-23 showed reproducible and dose-responsive inhibition of IA-rhodamine labeling of RNF4 ( FIG. 1 D , FIG. 5 ). Based on corresponding silver staining of RNF4 in these experiments, we found that TRH 1-163 may be causing protein precipitation. Based on gel-based ABPP analysis of general cysteine-reactivity in 231MFP lysates, YP 1-44 was much less selective compared to TRH 1-23 ( FIG. 5 ). Thus, TRH 1-23 appeared to be the most promising RNF4 hit ( FIG. 1 D ).

We next sought to identify the site-of-modification of TRH 1-23 within RNF4. We performed liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis of tryptic digests from TRH 1-23-treated RNF4 pure protein and found that TRH 1-23 covalently modified either, but not both, of the two zinc-coordinating cysteines CI 32 and CI 35 in the RING domain of RNF4 ( FIGS. 2 A, 2 B ). In support of its utility as a functional RNF4 recruiter, we wanted to see if TRH 1-23 had any effect upon RNF4 autoubiquitination activity, since previous studies had shown that mutation of these cysteines to serines inhibits RNF4 function 21-23 . Surprisingly, TRH 1-23 treatment does not inhibit RNF4 autoubiquitination activity in an in vitro reconstituted assay ( FIG. 2 C ). While we do not yet understand the underlying mechanism explaining the lack of RNF4 inhibition with TRH 1-23 treatment, we postulate that perhaps zinc may still bind in the coordination site, as three cysteines are unmodified by TRH 1-23, or that TRH 1-23 may fill the space usually occupied by zinc to maintain RNF4 activity. Nonetheless, this lack of RNF4 inhibition was ideal for its potential application as an E3 ligase recruiter.

While a promising non-functional ligand against RNF4, TRH 1-23 did not show sufficient potency to be useful as an RNF4 recruiter. We thus synthesized several TRH 1-23 analogs and used gel-based ABPP to test their potency and structure-activity relationships against RNF4 ( FIGS. 3 A- 3 B ). Among these analogs, we found CCW16, with an N-benzyl and 4-methoxyphenoxyphenyl substitution on the chloroacetamide scaffold, to be among the most potent of the analogs with reduced IA-rhodamine labeling of RNF4 observed down to 1 μM. Further confirmatory studies revealed a CCW16 50% inhibitory concentration (IC50) of 1.8 μM ( FIG. 3 C ). Based on the structure-activity relationships observed with TRH 1-23 analogs, we thought that the 4-methoxy group on CCW16 would be an ideal position for extending a linker to make an RNF4-based degrader.

To demonstrate that we could use CCW16 as a potential RNF4 recruiter for targeted protein degradation applications, we synthesized CCW-28-3, a bifunctional degrader linking CCW16 to the BRD4 inhibitor JQ1 ( FIG. 4 A ). CCW-28-3 showed higher potency for RNF4 than CCW16 with an IC50 of 0.54 μM ( FIG. 4 B ). Compellingly, treatment with CCW 28-3 degrades BRD4 in a dose-responsive manner in 231MFP breast cancer cells ( FIG. 4 C ) and this degradation is prevented by pre-treatment of cells with the proteasome inhibitor bortezomib (BTZ), the BRD4 inhibitor JQ1, as well as the E1 ubiquitin activating enzyme inhibitor TAK-243 ( FIGS. 4 D- 4 E ).

We next used isotopic tandem orthogonal proteolysis-enabled ABPP (isoTOP-ABPP) platforms to assess the proteome-wide selectivity of CCW 28-3 4,6,7,12 ( FIG. 6 ). We treated 231MFP cells with vehicle or CCW 28-3 and labeled the resulting proteomes with the cysteine-reactive iodoacetamide-alkyne (IA-alkyne) probe, followed by appendage of isotopically light or heavy TEV protease-cleavable biotin-azide tags onto probe-labeled proteins in vehicle and CCW-28-3-treated groups, respectively. Probe-modified peptides were enriched and eluted and analyzed using previously described methods for isoTOP-ABPP 4,6,7,12 . While we were not able to observe the probe-modified peptide for RNF4 in this experiment likely due to its low abundance compared to other IA-alkyne labeled proteins, we demonstrated that there are only 7 targets with isotopically light to heavy ratios greater than 4 out of 1114 total quantified probe-modified peptides identified Most notably, none of these off-targets of CCW 28-3 are part of the ubiquitin-proteasome system ( FIG. 6 ).

Because CCW-28-3 was not completely selective and we were targeting conserved zinc-coordinating cysteines across the RING family of E3 ligases, we wanted to confirm the contributions of RNF4 to CCW-28-3-mediated degradation of BRD4. Therefore, we compared CCW 28-3-mediated BRD4 degradation in control and RNF4 knockout HeLa cells. Convincingly, CCW 28-3-mediated degradation of BRD4 observed in HeLa control cells was not evident in RNF4 knockout cells ( FIG. 4 F ; FIG. 7 ). These data further indicate that CCW 28-3 degrades BRD4 through RNF4 recruitment.

Our study demonstrates the feasibility of using ABPP-based covalent ligand screening approaches to rapidly discover entry points into targeting E3 ligases and that these covalent ligand hits can be identified, optimized, and incorporated into degraders for targeted protein degradation applications. While CCW16 and CCW-28-3 are not yet completely selective for RNF4 in cells, we demonstrate that we can still degrade BRD4 in an RNF4-dependent manner. We note that CCW 28-3 does not degrade BRD4 as well as other previously reported BRD4 degraders such as MZ1 that utilizes a VHL-recruiter linked to JQ1 24 . Future medicinal chemistry efforts can be employed to optimize the potency and selectivity of CCW16 for RNF4 and to optimize linker positioning and composition of CCW 28-3 to promote better degradation of protein substrates. Nonetheless, CCW16 represents a novel, small-molecule E3 ligase recruiter for RNF4, beyond the four other E3 ligase recruiters that have been reported previously, targeting cereblon, VHL, MDM2, and cIAP 2 . We believe that the approaches described here can be utilized for future applications in expanding the scope of E3 ligase recruiters or modulators.

Covalent Ligand Library used in Initial Screen. The synthesis and characterization of many of the covalent ligands screened against RNF4 have been previously reported 4-6,13 .

Gel-Based ABPP. Gel-based ABPP methods were performed as previously described 5,6,25,26 . Pure recombinant human RNF4 was purchased from Boston Biochem (K-220). RNF4 (0.25 μg) was diluted into 50 μL of PBS and 1p L of either DMSO (vehicle) or covalently acting small molecule to achieve the desired concentration. After 30 minutes at room temperature, the samples were treated with 250 nM IA-Rhodamine (Setareh Biotech, 6222, prepared in anhydrous DMSO) for 1 h at room temperature. Samples were then diluted with 20 μL of 4× reducing Laemmli SDS sample loading buffer (Alfa Aesar) and heated at 90° C. for 5 min. The samples were separated on precast 4-20% Criterion TGX gels (Bio-Rad Laboratories, Inc.). Fluorescent imaging was performed on a ChemiDoc MP (Bio-Rad Laboratories, Inc) inhibition of target labeling was assessed by densitometry using ImageJ.

LC-MS/MS analysis of RNF4. Purified RNF4 (10 μg) was diluted into 80 μL of PBS and treated for 30 min with DMSO or compound (50 μM). The DMSO control was then treated with light iodoacetamide (IA) while the compound treated sample was incubated with heavy IA for 1 h each at room temperature (100 μM, Sigma-Aldrich, 721328). The samples were precipitated by additional of 20 μL of 100% (w/v) TCA and combined pairwise before cooling to −80 C for one hour. The combined sample was then spun for at max speed for 20 min at 4° C., supernatant is carefully removed and the sample is washed with ice cold 0.01 M HCl/90% acetone solution. The sample was then resuspended in 2.4 M urea containing 0.1% Protease Max (Promega Corp. V2071) in 100 mM ammonium bicarbonate buffer. The samples were reduced with 10 mM TCEP at 60° C. for 30 min. The samples were then diluted 50% with PBS before sequencing grade trypsin (1 ug per sample, Promega Corp, V5111) was added for an overnight incubation at 37° C. The next day the sample was centrifuged at 13200 rpm for 30 min. The supernatant was transferred to a new tube and acidified to a final concentration of 5% formic acid and stored at −80° C. until MS analysis.

RNF4 ubiquitination assay. For in vitro auto-ubiquitination assay, 200 nM RNF4 in 15 μL ubiquitination assay buffer (50 mM Tris, 150 mM NaCl, 5 mM MgCl 2 , 5 mM DTT, pH 7.4) was pre-incubated with DMSO vehicle or the covalently-acting compound for 30 min at room temperature. Subsequently, UBE1 (50 nM, Boston Biochem, E-305), UBE2D1 (400 nM Boston Bichem, E2-615), Flag-ubiquitin (4000 nM, Boston Biochem, U-120) and ATP (200 μM) were added in ubiquitination assay buffer bring the total volume to 30 μL. The mixture was incubated at RT for 30 min before quenching with 10 μL of 4× Laemmli's buffer. Ubiquitination activity was measured by separation on an SDS-PAGE gel and western blotting as previously described.

Cell Culture. The 231MFP cells were obtained from Prof. Benjamin Cravatt and were generated from explanted tumor xenografts of MDA-MB-231 cells as previously described 27 . RNF4 knockout HeLa cells were purchased from EdiGene USA (CL0033025003A). RNF4 wild-type HeLa cells were provided by EdiGene USA or the UC Berkeley Cell Culture Facility. 231MFP cells were cultured in L-15 media (Corning) containing 10% (v/v) fetal bovine serum (FBS) and maintained at 37° C. with 0% CO 2 . HeLa cells were cultured in DMEM media (Corning) containing 10% (v/v) fetal bovine serum (FBS) and maintained at 37° C. with 5% CO 2 .

Cell based degrader assays. For assaying degrader activity, cells were seeded (500,000 for 231MFP cells, 300,000 for HeLa cells) into a 6 cm tissue culture dish (Corning) in 2.0-2.5 mL of media and allowed to adhere overnight. The following morning, media was replaced with complete media containing the desired concentration of compound diluted from a 1000× stock in DMSO. At the specified timepoint, cells were washed once with PBS on ice, before 150 uL of lysis buffer was added to the plate (10 mM sodium phosphate, 150 mM NaCl, 0.1% SDS, 0.5% sodium deoxycholate, 1% Triton X100). The cells were incubated in lysis buffer for 5 min before scraping and transfer to microcentrifuge tubes. The lysates were then frozen at −80 C or immediately processed for western blotting. To prepare for western blotting, the lysates were cleared with 20,000 g spin for 10 min and the resulting supernatants quantified via BCA assay. The lysates were normalized by dilution with PBS to match the lowest concentration lysate and appropriate amount of 4× Laemmli's reducing buffer added.

Western blotting. Antibodies to RNF4 (Proteintech, 17810-1-AP, 1:1000), GAPDH (Proteintech, 60004-1-IG, 1:5000), BRD4 (Abcam, Ab128874, 1:1000), and beta-actin (Proteintech Group Inc., 6609-1-IG, 1:7000) were obtained from the specified commercial sources and dilutions were prepared in 5% BSA/TBST at the specified dilutions. Proteins were resolved by SDS/PAGE and transferred to nitrocellulose membranes using the iBlot system (Invitrogen). Blots were blocked with 5% BSA in Tris-buffered saline containing Tween 20 (TBST) solution for 1 h at room temperature, washed in TBST, and probed with primary antibody diluted in recommended diluent per manufacturer overnight at 4° C. Following washes with TBST, the blots were incubated in the dark with secondary antibodies purchased from Ly-Cor and used at 1:10,000 dilution in 5% BSA in TBST at room temperature. Blots were visualized using an Odyssey Li-Cor scanner after additional washes. If additional primary antibody incubations were required the membrane was stripped using ReBlot Plus Strong Antibody Stripping Solution (EMD Millipore, 2504), washed and blocked again before being re-incubated with primary antibody.

IsoTOP-ABPP chemoproteomic studies. IsoTOP-ABPP studies were done as previously reported 4,6,7,12 . Briefly, cells were lysed by probe sonication in PBS and protein concentrations were measured by BCA assay 28 . For in situ experiments, cells were treated for 90 min with either DMSO vehicle or covalently-acting small molecule (from 1000×DMSO stock) before cell collection and lysis. For in vitro experiments, proteome samples diluted in PBS (4 mg of proteome per biological replicate) were treated with a DMSO vehicle or covalently-acting small molecule for 30 min at room temper